Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MRPL58 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14197
Molecular weight:
18.10 kDa

Original price was: €278.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Asp71–Asp206
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MRPL58 Protein, N-His

Product name ARO-P11607-100
Uniprot ID Q14197
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Molecular weight 18.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp71-Asp206
Aliases /Synonyms DS1, MRPL58, Immature colon carcinoma transcript 1 protein, Digestion substraction 1, Mitochondrial large ribosomal subunit protein mL62, DS-1, ICT1, MRP-L58, Peptidyl-tRNA hydrolase ICT1, mitochondrial, 39S ribosomal protein L58, mitochondrial
Reference ARO-P11607
Note For research use only.
Molecular Constructor
Asp71–Asp206
Product name ARO-P11607-1MG
Uniprot ID Q14197
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Molecular weight 18.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp71-Asp206
Aliases /Synonyms DS1, MRPL58, Immature colon carcinoma transcript 1 protein, Digestion substraction 1, Mitochondrial large ribosomal subunit protein mL62, DS-1, ICT1, MRP-L58, Peptidyl-tRNA hydrolase ICT1, mitochondrial, 39S ribosomal protein L58, mitochondrial
Reference ARO-P11607
Note For research use only.
Molecular Constructor
Asp71–Asp206
Product name ARO-P11607-50
Uniprot ID Q14197
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Molecular weight 18.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp71-Asp206
Aliases /Synonyms DS1, MRPL58, Immature colon carcinoma transcript 1 protein, Digestion substraction 1, Mitochondrial large ribosomal subunit protein mL62, DS-1, ICT1, MRP-L58, Peptidyl-tRNA hydrolase ICT1, mitochondrial, 39S ribosomal protein L58, mitochondrial
Reference ARO-P11607
Note For research use only.
Molecular Constructor
Asp71–Asp206

Introduction

Recombinant Human MRPL58 Protein, also known as Mitochondrial Ribosomal Protein L58, is a protein that plays a crucial role in the structure and function of the mitochondrial ribosome. This protein is produced by recombinant DNA technology, making it a highly valuable tool in various scientific and medical applications.

Structure of Recombinant Human MRPL58 Protein

Recombinant Human MRPL58 Protein is composed of 157 amino acids and has a molecular weight of approximately 18 kDa. It contains a conserved S1 domain, which is responsible for RNA binding, and a highly conserved ribosomal protein L58 domain. This protein also contains a mitochondrial targeting sequence, which directs it to the mitochondria where it is involved in the assembly of the mitochondrial ribosome.

Activity of Recombinant Human MRPL58 Protein

Recombinant Human MRPL58 Protein is a key component of the large subunit of the mitochondrial ribosome. It plays a crucial role in the translation of mitochondrial DNA into proteins that are essential for the proper functioning of the mitochondria. This protein is involved in the formation and stabilization of the ribosome, as well as in the decoding of mRNA during protein synthesis.

In addition to its role in translation, Recombinant Human MRPL58 Protein has been shown to be involved in the regulation of mitochondrial gene expression. It has been found to interact with other proteins, such as MRPL12 and MRPL24, to form a complex that regulates the expression of mitochondrial genes. This highlights the multifunctional nature of this protein and its importance in maintaining the proper functioning of the mitochondria.

Application of Recombinant Human MRPL58 Protein

Recombinant Human MRPL58 Protein has a wide range of applications in both basic research and medical fields. Its ability to specifically bind to mitochondrial RNA makes it a valuable tool for studying the structure and function of the mitochondrial ribosome. This protein has been used in various studies to understand the role of the ribosome in mitochondrial diseases and aging.

In the medical field, Recombinant Human MRPL58 Protein has been used as an antigen in the development of diagnostic assays for mitochondrial disorders. It has also been investigated as a potential therapeutic target for these disorders. Furthermore, this protein has shown promise in cancer research, as it has been found to be overexpressed in certain types of cancer cells, making it a potential target for cancer treatments.

Conclusion

In summary, Recombinant Human MRPL58 Protein is a crucial component of the mitochondrial ribosome, involved in translation and gene expression regulation. Its structure and function make it a valuable tool for studying the mitochondria and its role in various diseases. With its diverse applications in both research and medical fields, this protein continues to be an important focus of scientific investigation.

Recombinant Human MRPL58 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MRPL58 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products