Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NHS3
Molecular weight:
34.46 kDa

Original price was: €245.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Asn359–Pro412
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His

Product name ARO-P11511-100
Uniprot ID Q8NHS3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTP
Molecular weight 34.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn359-Pro412
Aliases /Synonyms CLN7, MFSD8, Major facilitator superfamily domain-containing protein 8, Ceroid-lipofuscinosis neuronal protein 7
Reference ARO-P11511
Note For research use only.
Molecular Constructor
Asn359–Pro412
Product name ARO-P11511-1MG
Uniprot ID Q8NHS3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTP
Molecular weight 34.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn359-Pro412
Aliases /Synonyms CLN7, MFSD8, Major facilitator superfamily domain-containing protein 8, Ceroid-lipofuscinosis neuronal protein 7
Reference ARO-P11511
Note For research use only.
Molecular Constructor
Asn359–Pro412
Product name ARO-P11511-50
Uniprot ID Q8NHS3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTP
Molecular weight 34.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn359-Pro412
Aliases /Synonyms CLN7, MFSD8, Major facilitator superfamily domain-containing protein 8, Ceroid-lipofuscinosis neuronal protein 7
Reference ARO-P11511
Note For research use only.
Molecular Constructor
Asn359–Pro412

Introduction

Recombinant Human MFSD8/CLN7 protein is a synthetic version of the human MFSD8/CLN7 protein, which is encoded by the MFSD8 gene. This protein is involved in the transport of lysosomal enzymes and other proteins to the lysosomes, which are cellular organelles responsible for breaking down and recycling cellular waste. Mutations in the MFSD8 gene have been linked to a rare neurodegenerative disorder known as CLN7 disease, which is characterized by the accumulation of waste materials in the brain and other tissues. Recombinant Human MFSD8/CLN7 protein has been extensively studied and is now being used in various research and medical applications.

Structure

Recombinant Human MFSD8/CLN7 protein is a 59 kDa protein composed of 518 amino acids. It contains a signal peptide at the N-terminus, which is responsible for targeting the protein to the lysosomes. The protein also contains 12 transmembrane domains, which are essential for its function in transporting proteins across the lysosomal membrane. The cytoplasmic domain of the protein is involved in interacting with other proteins and regulating its activity.

Activity

The main activity of Recombinant Human MFSD8/CLN7 protein is to transport lysosomal enzymes and other proteins from the Golgi apparatus to the lysosomes. This process is crucial for maintaining the proper functioning of the lysosomes and preventing the accumulation of waste materials. The protein achieves this by binding to the proteins in the Golgi apparatus and facilitating their transport across the lysosomal membrane. It also plays a role in the sorting and targeting of proteins to the lysosomes, ensuring that they are delivered to the correct location within the cell.

Application

Recombinant Human MFSD8/CLN7 protein has various applications in both research and medicine. In research, it is used as an antigen for studying the structure and function of the protein. It can also be used to produce antibodies for detecting the protein in tissues and cells. Additionally, Recombinant Human MFSD8/CLN7 protein has been used in biochemical and biophysical studies to understand its interactions with other proteins and its role in lysosomal transport.

In medicine, Recombinant Human MFSD8/CLN7 protein has shown promise as a potential treatment for CLN7 disease. Studies have shown that the protein can restore the transport of lysosomal enzymes in cells with mutated MFSD8 gene, thereby reducing the accumulation of waste materials. This has the potential to slow down the progression of the disease and improve the quality of life for affected individuals. Moreover, Recombinant Human MFSD8/CLN7 protein has also been explored as a potential therapeutic target for other lysosomal storage disorders.

Conclusion

In summary, Recombinant Human MFSD8/CLN7 protein is a synthetic version of the human MFSD8/CLN7 protein that plays a crucial role in lysosomal transport. Its structure and activity have been extensively studied, and it has various applications in research and medicine. As research on this protein continues, it holds the potential to provide insights into lysosomal transport and aid in the development of treatments for lysosomal storage disorders.

Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products