Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MARCO Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UEW3
Molecular weight:
23.37 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Ser421–Val520
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MARCO Protein, N-His-SUMO

Product name ARO-P11567-100
Uniprot ID Q9UEW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Molecular weight 23.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser421-Val520
Aliases /Synonyms SCARA2, Scavenger receptor class A member 2, MARCO, Macrophage receptor MARCO, Macrophage receptor with collagenous structure
Reference ARO-P11567
Note For research use only.
Molecular Constructor
Ser421–Val520
Product name ARO-P11567-1MG
Uniprot ID Q9UEW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Molecular weight 23.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser421-Val520
Aliases /Synonyms SCARA2, Scavenger receptor class A member 2, MARCO, Macrophage receptor MARCO, Macrophage receptor with collagenous structure
Reference ARO-P11567
Note For research use only.
Molecular Constructor
Ser421–Val520
Product name ARO-P11567-50
Uniprot ID Q9UEW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Molecular weight 23.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser421-Val520
Aliases /Synonyms SCARA2, Scavenger receptor class A member 2, MARCO, Macrophage receptor MARCO, Macrophage receptor with collagenous structure
Reference ARO-P11567
Note For research use only.
Molecular Constructor
Ser421–Val520

Introduction

Recombinant Human MARCO Protein is a type of recombinant protein that plays a crucial role in the immune system. It is a transmembrane receptor protein that is expressed on the surface of macrophages, which are a type of white blood cell responsible for engulfing and destroying foreign particles in the body. This protein is involved in various immune responses and has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human MARCO Protein

The human MARCO gene is located on chromosome 2 and encodes for a protein with a molecular weight of approximately 75 kDa. The protein consists of 522 amino acids and has a typical structure of a scavenger receptor, with a large extracellular domain, a transmembrane domain, and a short cytoplasmic tail. The extracellular domain contains a ligand-binding region, while the cytoplasmic tail contains signaling motifs that are involved in the activation of downstream signaling pathways.

Activity of Recombinant Human MARCO Protein

MARCO protein is primarily expressed on the surface of macrophages, where it plays a key role in the recognition and binding of various foreign particles, such as bacteria, viruses, and other pathogens. This binding triggers a signaling cascade that leads to the activation of the macrophage and the subsequent engulfment and destruction of the foreign particle. This process is crucial for the immune system’s ability to defend against infections and diseases.

In addition to its role in immune responses, MARCO protein has also been shown to be involved in other cellular processes, such as phagocytosis, cell adhesion, and inflammation. It has been reported that MARCO protein can also act as a pattern recognition receptor, recognizing specific molecular patterns on the surface of pathogens and triggering an immune response.

Application of Recombinant Human MARCO Protein

Due to its crucial role in immune responses, Recombinant Human MARCO Protein has been studied extensively for its potential applications in various fields. One of the main applications of this protein is in the development of vaccines. By using MARCO protein as an antigen, researchers have been able to induce a strong immune response against specific pathogens, leading to the development of effective vaccines. This has been particularly useful in the development of vaccines against bacterial infections, such as tuberculosis and pneumonia.

In addition to its use in vaccine development, Recombinant Human MARCO Protein has also been studied for its potential in cancer therapy. It has been reported that MARCO protein is highly expressed on the surface of certain types of cancer cells, making it a potential target for cancer treatment. By using MARCO protein as a target, researchers have been able to develop targeted therapies that specifically target cancer cells, while sparing healthy cells.

Moreover, Recombinant Human MARCO Protein has also been studied for its potential in the diagnosis and treatment of various inflammatory diseases, such as rheumatoid arthritis and atherosclerosis. By targeting MARCO protein, researchers have been able to develop diagnostic tools and therapies that can specifically target and modulate the inflammatory response, leading to improved treatment outcomes.

Conclusion

In conclusion, Recombinant Human MARCO Protein is a vital component of the immune system, playing a crucial role in immune responses and other cellular processes. Its unique structure and activity make it a promising target for various applications, including vaccine development, cancer therapy, and treatment of inflammatory diseases. Further research and development in this field will undoubtedly lead to the discovery of new and innovative ways to utilize this protein for the benefit of human health.

Recombinant Human MARCO Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MARCO Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products