Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MACROH2A2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9P0M6
Molecular weight:
22.98 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Gly182–Lys372
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MACROH2A2 Protein, N-His

Product name ARO-P11696-100
Uniprot ID Q9P0M6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
Molecular weight 22.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly182-Lys372
Aliases /Synonyms Histone macroH2A2, H2AFY2, Core histone macro-H2A.2, mH2A2, MACROH2A2
Reference ARO-P11696
Note For research use only.
Molecular Constructor
Gly182–Lys372
Product name ARO-P11696-1MG
Uniprot ID Q9P0M6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
Molecular weight 22.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly182-Lys372
Aliases /Synonyms Histone macroH2A2, H2AFY2, Core histone macro-H2A.2, mH2A2, MACROH2A2
Reference ARO-P11696
Note For research use only.
Molecular Constructor
Gly182–Lys372
Product name ARO-P11696-50
Uniprot ID Q9P0M6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
Molecular weight 22.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly182-Lys372
Aliases /Synonyms Histone macroH2A2, H2AFY2, Core histone macro-H2A.2, mH2A2, MACROH2A2
Reference ARO-P11696
Note For research use only.
Molecular Constructor
Gly182–Lys372

Recombinant Human MACROH2A2 Protein: Structure, Activity, and Application

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various scientific and medical applications. One such protein is the Recombinant Human MACROH2A2 Protein, which has gained significant attention in recent years due to its unique structure, diverse activities, and potential therapeutic applications. In this article, we will explore the structure, activity, and application of this recombinant protein in detail.

Structure of Recombinant Human MACROH2A2 Protein

The Recombinant Human MACROH2A2 Protein, also known as macroH2A.2, is a member of the macroH2A family of histone variants. It is encoded by the MACROH2A2 gene located on chromosome 20q13.33 in humans. The protein consists of 383 amino acids with a molecular weight of approximately 40 kDa. It contains a central globular domain, a highly conserved C-terminal histone fold domain, and a variable N-terminal tail region.

The most striking feature of the MACROH2A2 protein is its unique C-terminal histone fold domain, which has an extended structure compared to other histone variants. This domain contains a highly conserved macro domain, which is involved in various cellular processes such as DNA repair, transcription, and chromatin remodeling. The N-terminal tail region of the protein is rich in lysine residues, which are potential sites for post-translational modifications, including acetylation, methylation, and phosphorylation.

Activity of Recombinant Human MACROH2A2 Protein

The Recombinant Human MACROH2A2 Protein has diverse activities that are crucial for maintaining genomic stability and regulating gene expression. It has been reported to play a role in DNA damage response by facilitating the recruitment of repair proteins to the damaged sites. Additionally, it is involved in transcriptional regulation by modulating the accessibility of DNA to transcription factors and RNA polymerase.

The macroH2A.2 protein has also been linked to cellular senescence, a process that limits the proliferative capacity of cells and plays a critical role in aging and age-related diseases. Studies have shown that the overexpression of this protein can induce senescence in cancer cells, making it a potential target for cancer therapy.

Application of Recombinant Human MACROH2A2 Protein

The unique structure and diverse activities of the Recombinant Human MACROH2A2 Protein make it a valuable tool in various scientific and medical applications. One of its primary applications is in the study of epigenetics, a field that investigates heritable changes in gene expression without altering the DNA sequence. The macroH2A.2 protein is an essential epigenetic regulator, and its recombinant form is widely used in research to understand its role in chromatin remodeling and gene expression.

Furthermore, the MACROH2A2 protein has potential therapeutic applications in cancer treatment. As mentioned earlier, its overexpression can induce cellular senescence in cancer cells, making it a promising target for cancer therapy. Additionally, studies have shown that the protein is downregulated in various cancers, and its restoration can inhibit tumor growth and metastasis.

Conclusion

In conclusion, the Recombinant Human MACROH2A2 Protein is a unique and versatile protein with diverse activities and potential therapeutic applications. Its recombinant form has become an essential tool in various fields, including epigenetics and cancer research. Further studies on this protein may reveal new insights into its functions and potential applications in the future.

Recombinant Human MACROH2A2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MACROH2A2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products