Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LOX, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P28300
Molecular weight:
31.34 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
His Asp169–Tyr417
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LOX, N-His

Product name ARO-P13714-100
Uniprot ID P28300
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Molecular weight 31.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp169-Tyr417
Aliases /Synonyms Lysyl oxidase, LOX, Protein-lysine 6-oxidase
Reference ARO-P13714
Note For research use only.
Molecular Constructor
His Asp169–Tyr417
Product name ARO-P13714-1MG
Uniprot ID P28300
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Molecular weight 31.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp169-Tyr417
Aliases /Synonyms Lysyl oxidase, LOX, Protein-lysine 6-oxidase
Reference ARO-P13714
Note For research use only.
Molecular Constructor
His Asp169–Tyr417
Product name ARO-P13714-50
Uniprot ID P28300
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Molecular weight 31.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp169-Tyr417
Aliases /Synonyms Lysyl oxidase, LOX, Protein-lysine 6-oxidase
Reference ARO-P13714
Note For research use only.
Molecular Constructor
His Asp169–Tyr417

Introduction
Recombinant Human LOX (lysyl oxidase) is a type of recombinant protein that plays a crucial role in extracellular matrix (ECM) remodeling and tissue development. It is a copper-dependent enzyme that catalyzes the cross-linking of collagen and elastin, two major components of the ECM. In this article, we will delve into the structure, activity, and applications of Recombinant Human LOX.

Structure of Recombinant Human LOX
Recombinant Human LOX is a homodimeric protein, meaning it is composed of two identical subunits. Each subunit consists of four domains: a signal peptide, a propeptide, a catalytic domain, and a cytokine receptor-like domain. The signal peptide directs the protein to the secretory pathway, while the propeptide is involved in the proper folding and activation of the enzyme. The catalytic domain contains the active site and is responsible for the cross-linking activity of LOX. The cytokine receptor-like domain is thought to play a role in the binding and activation of LOX by its substrate, lysine.

Activity of Recombinant Human LOX
The primary function of Recombinant Human LOX is to catalyze the oxidative deamination of lysine residues in collagen and elastin, leading to the formation of cross-links between these molecules. This process is crucial for the stability and integrity of the ECM, as well as for tissue development and repair. LOX is also involved in the regulation of cell adhesion, migration, and proliferation, making it a key player in tissue homeostasis.

Applications of Recombinant Human LOX
The unique properties of Recombinant Human LOX make it a valuable tool in various fields of research and biotechnology. Here are some of its applications:

1. Wound healing: LOX plays a critical role in the formation of scar tissue during wound healing. Recombinant Human LOX has been shown to accelerate wound closure and improve the quality of scar tissue, making it a potential therapeutic agent for wound healing.

2. Tissue engineering: The ability of LOX to cross-link collagen and elastin makes it a useful tool in tissue engineering. Recombinant Human LOX can be used to create artificial scaffolds for tissue regeneration, as well as to enhance the stability and mechanical properties of tissue-engineered constructs.

3. Cancer research: LOX has been implicated in various aspects of cancer progression, including tumor growth, invasion, and metastasis. Recombinant Human LOX can be used to study the role of LOX in cancer and to develop potential therapeutic strategies targeting this enzyme.

4. Diagnosis and prognosis: The expression and activity of LOX have been linked to various diseases, including fibrosis, cardiovascular diseases, and cancer. Recombinant Human LOX can be used as a diagnostic and prognostic marker for these diseases, as well as a potential therapeutic target.

5. Drug development: Given its crucial role in ECM remodeling and tissue development, LOX has emerged as a potential target for drug development. Recombinant Human LOX can be used in high-throughput screening assays to identify small molecule inhibitors or activators of this enzyme, which could lead to the development of novel therapeutics for various diseases.

Conclusion
Recombinant Human LOX is a versatile enzyme with important functions in ECM remodeling and tissue development. Its unique structure and activity make it a valuable tool in various fields of research and biotechnology, including wound healing, tissue engineering, cancer research, diagnosis and prognosis, and drug development. Further studies on the structure-function relationship of LOX and its role in disease will undoubtedly uncover new applications for this enzyme and contribute to the development of new therapies.

Recombinant Human LOX, N-His

There are no reviews yet.

Be the first to review “Recombinant Human LOX, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products