Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KRT12 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99456
Molecular weight:
22.81 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Gly103–Gln199
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KRT12 Protein, N-His-SUMO

Product name ARO-P11230-100
Uniprot ID Q99456
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASI
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Gln199
Aliases /Synonyms Keratin-12, Keratin, type I cytoskeletal 12, Cytokeratin-12, K12, CK-12, KRT12
Reference ARO-P11230
Note For research use only.
Molecular Constructor
Gly103–Gln199
Product name ARO-P11230-1MG
Uniprot ID Q99456
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASI
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Gln199
Aliases /Synonyms Keratin-12, Keratin, type I cytoskeletal 12, Cytokeratin-12, K12, CK-12, KRT12
Reference ARO-P11230
Note For research use only.
Molecular Constructor
Gly103–Gln199
Product name ARO-P11230-50
Uniprot ID Q99456
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASI
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Gln199
Aliases /Synonyms Keratin-12, Keratin, type I cytoskeletal 12, Cytokeratin-12, K12, CK-12, KRT12
Reference ARO-P11230
Note For research use only.
Molecular Constructor
Gly103–Gln199

Introduction to Recombinant Human KRT12 Protein

Recombinant Human KRT12 Protein, also known as Keratin 12, is a protein that is encoded by the KRT12 gene in humans. It belongs to the keratin family of proteins, which are important structural components of epithelial cells. These proteins are responsible for providing strength and integrity to the cells, and play a crucial role in the maintenance and protection of various tissues in the body.

Structure of Recombinant Human KRT12 Protein

Recombinant Human KRT12 Protein is a 53 kDa protein that is composed of 480 amino acids. It is a type I keratin, which means it has a molecular weight of approximately 40-65 kDa and is found in the acidic keratin fraction. The protein has a highly conserved structure, with a central alpha-helical rod domain that is flanked by non-helical head and tail domains. This structure is characteristic of all keratin proteins and is important for their function.

Activity of Recombinant Human KRT12 Protein

Recombinant Human KRT12 Protein is primarily expressed in the cornea, which is the transparent outer layer of the eye. It is also found in the conjunctiva, a mucous membrane that covers the front of the eye and lines the inside of the eyelids. The main function of KRT12 is to provide structural support and protection to these tissues. It forms intermediate filaments, along with other keratin proteins, which are essential for maintaining the structural integrity of the cornea and conjunctiva.

In addition to its structural role, Recombinant Human KRT12 Protein also plays a role in cell signaling and differentiation. Studies have shown that KRT12 is involved in the regulation of cell proliferation and migration, as well as wound healing in the cornea. It also has antimicrobial properties, which help protect the eye from infections.

Application of Recombinant Human KRT12 Protein

Recombinant Human KRT12 Protein has several potential applications in the field of ophthalmology. One of the main applications is in the treatment of corneal diseases and injuries. Mutations in the KRT12 gene have been linked to various corneal disorders, such as Meesmann corneal dystrophy and corneal epithelial fragility syndrome. Recombinant Human KRT12 Protein can be used to replace the defective or missing KRT12 protein in these conditions, providing structural support and improving the function of the cornea.

In addition, Recombinant Human KRT12 Protein can also be used in tissue engineering and regenerative medicine. It has been shown to promote the growth and differentiation of corneal epithelial cells, which are crucial for the repair and regeneration of damaged corneal tissue. This makes it a promising candidate for developing new therapies for corneal injuries and diseases.

Furthermore, Recombinant Human KRT12 Protein can also be used as an antigen in diagnostic tests for corneal diseases. Antibodies against KRT12 can be used to detect the presence of the protein in tissue samples, which can aid in the diagnosis and monitoring of corneal disorders.

Conclusion

In summary, Recombinant Human KRT12 Protein is a vital component of the cornea and conjunctiva, playing a crucial role in maintaining the structural integrity of these tissues. Its potential applications in the treatment of corneal diseases and injuries, as well as in tissue engineering and diagnostics, make it a valuable protein in the field of ophthalmology. Further research on the structure, activity and function of KRT12 will provide a better understanding of its role in maintaining the health of the eye and may lead to the development of new therapies for corneal disorders.

Recombinant Human KRT12 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human KRT12 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products