Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KLF7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75840
Molecular weight:
21.38 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Met1–Ser175
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KLF7 Protein, N-His

Product name ARO-P11963-100
Uniprot ID O75840
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSS
Molecular weight 21.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser175
Aliases /Synonyms Krueppel-like factor 7, UKLF, KLF7, Ubiquitous krueppel-like factor
Reference ARO-P11963
Note For research use only.
Molecular Constructor
Met1–Ser175
Product name ARO-P11963-1MG
Uniprot ID O75840
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSS
Molecular weight 21.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser175
Aliases /Synonyms Krueppel-like factor 7, UKLF, KLF7, Ubiquitous krueppel-like factor
Reference ARO-P11963
Note For research use only.
Molecular Constructor
Met1–Ser175
Product name ARO-P11963-50
Uniprot ID O75840
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSS
Molecular weight 21.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser175
Aliases /Synonyms Krueppel-like factor 7, UKLF, KLF7, Ubiquitous krueppel-like factor
Reference ARO-P11963
Note For research use only.
Molecular Constructor
Met1–Ser175

Title: Introduction to Recombinant Human KLF7 Protein

Recombinant human KLF7 protein is a highly versatile and valuable tool in the field of molecular biology. This protein is a member of the Krüppel-like factor (KLF) family of transcription factors, which play crucial roles in regulating gene expression and cellular processes. The recombinant form of KLF7 protein is produced through genetic engineering techniques, making it a powerful tool for studying its structure, activity, and applications.

Structure of Recombinant Human KLF7 Protein

The human KLF7 gene is located on chromosome 2 and encodes for a protein of 367 amino acids. The recombinant form of KLF7 protein is typically expressed in E. coli or mammalian cells, and its structure is similar to the native protein. It consists of a DNA-binding domain (DBD) and a transcriptional activation domain (TAD), which are essential for its function as a transcription factor.

The DBD of KLF7 protein contains three Cys2His2-type zinc fingers, which are responsible for binding to specific DNA sequences in the regulatory regions of target genes. The TAD, on the other hand, interacts with other transcriptional co-regulators to activate or repress gene expression. The recombinant form of KLF7 protein can also be modified to include additional functional domains, such as protein tags or fusion partners, to facilitate purification and detection.

Activity of Recombinant Human KLF7 Protein

The primary function of KLF7 protein is to regulate gene expression by binding to specific DNA sequences and modulating the activity of target genes. It has been shown to play important roles in various cellular processes, including cell proliferation, differentiation, and development. The activity of recombinant KLF7 protein can be studied using various techniques, such as electrophoretic mobility shift assays (EMSA) and chromatin immunoprecipitation (ChIP).

Recombinant KLF7 protein has also been shown to interact with other transcription factors and co-regulators, forming a complex network of regulatory proteins that control gene expression. This protein has been implicated in several diseases, including cancer, cardiovascular disorders, and neurological disorders, highlighting its potential as a therapeutic target.

Applications of Recombinant Human KLF7 Protein

The recombinant form of KLF7 protein has a wide range of applications in both basic research and drug development. Its ability to regulate gene expression makes it a valuable tool for studying the function of specific genes and their role in various cellular processes. It can also be used to identify potential drug targets and screen for compounds that modulate its activity.

Recombinant KLF7 protein has also been used in the development of gene therapy strategies for diseases caused by mutations or dysregulation of KLF7. It has been shown to have a protective effect on neurons in models of neurodegenerative diseases, making it a potential therapeutic agent for these conditions.

In addition, recombinant KLF7 protein has been used in the production of diagnostic kits for detecting KLF7 levels in patient samples. This can aid in the diagnosis and monitoring of diseases associated with KLF7 dysregulation.

Conclusion

In summary, recombinant human KLF7 protein is a valuable tool for studying its structure, activity, and applications. Its role as a transcription factor in regulating gene expression makes it an important player in various cellular processes and diseases. With its versatility and potential for therapeutic applications, recombinant KLF7 protein continues to be an essential component in the toolkit of molecular biologists.

Recombinant Human KLF7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KLF7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products