Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KIAA0586/TALPID3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BVV6
Molecular weight:
13.72 kDa

Original price was: €415.00.Current price is: €329.00.

100ug 21% OFF + 329 loyalty points
Thr461–Lys558
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KIAA0586/TALPID3 Protein, N-His

Product name ARO-P11420-100
Uniprot ID Q9BVV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TTNTTRSVLKDAEKILRGVQNNKKVLEENLEAIIRAKDGAAMYSLINALSTNREMSEKIRIRKTVDEWIKTISAEIQDELSRTDYEQKRFDQKNQRTK
Molecular weight 13.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr461-Lys558
Aliases /Synonyms KIAA0586, TALPID3, Protein TALPID3
Reference ARO-P11420
Note For research use only.
Molecular Constructor
Thr461–Lys558
Product name ARO-P11420-1MG
Uniprot ID Q9BVV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TTNTTRSVLKDAEKILRGVQNNKKVLEENLEAIIRAKDGAAMYSLINALSTNREMSEKIRIRKTVDEWIKTISAEIQDELSRTDYEQKRFDQKNQRTK
Molecular weight 13.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr461-Lys558
Aliases /Synonyms KIAA0586, TALPID3, Protein TALPID3
Reference ARO-P11420
Note For research use only.
Molecular Constructor
Thr461–Lys558
Product name ARO-P11420-50
Uniprot ID Q9BVV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TTNTTRSVLKDAEKILRGVQNNKKVLEENLEAIIRAKDGAAMYSLINALSTNREMSEKIRIRKTVDEWIKTISAEIQDELSRTDYEQKRFDQKNQRTK
Molecular weight 13.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr461-Lys558
Aliases /Synonyms KIAA0586, TALPID3, Protein TALPID3
Reference ARO-P11420
Note For research use only.
Molecular Constructor
Thr461–Lys558

Introduction

Recombinant Human KIAA0586/TALPID3 Protein, also known as KIAA0586 or TALPID3, is a protein that plays a crucial role in the development and maintenance of various tissues and organs in the human body. It is a recombinant protein, meaning it is produced through genetic engineering techniques, and has been extensively studied for its structure, activity, and potential applications in various fields of research.

Structure of Recombinant Human KIAA0586/TALPID3 Protein

The KIAA0586/TALPID3 protein is encoded by the KIAA0586 gene, located on chromosome 3 in humans. It is composed of 1,721 amino acids and has a molecular weight of approximately 190 kDa. The protein contains several functional domains, including a coiled-coil domain, a leucine zipper domain, and a WD40 repeat domain. These domains play a crucial role in the protein’s function and interactions with other proteins.

Activity of Recombinant Human KIAA0586/TALPID3 Protein

KIAA0586/TALPID3 is a multi-functional protein that is involved in various cellular processes. It is primarily known for its role in the regulation of cilia formation and function. Cilia are hair-like structures present on the surface of many cells, and they play a crucial role in cell signaling, sensory perception, and fluid movement. KIAA0586/TALPID3 is required for the proper formation and function of cilia, and its absence or dysfunction can lead to various developmental disorders, such as ciliopathies.

In addition to its role in cilia formation, KIAA0586/TALPID3 is also involved in the regulation of the cell cycle and cell division. It interacts with other proteins involved in these processes, and its dysfunction can lead to abnormal cell growth and division, which is often seen in cancer cells.

Applications of Recombinant Human KIAA0586/TALPID3 Protein

The unique structure and activity of KIAA0586/TALPID3 make it a valuable tool in various fields of research, including developmental biology, cell biology, and cancer research. Recombinant Human KIAA0586/TALPID3 protein can be used in in vitro studies to investigate its role in cilia formation and function, as well as its interactions with other proteins involved in these processes.

Furthermore, the protein can also be used in in vivo studies, where its expression can be manipulated to study its effects on tissue and organ development. This can provide valuable insights into the role of KIAA0586/TALPID3 in various developmental disorders and diseases.

In addition to its research applications, Recombinant Human KIAA0586/TALPID3 protein also has potential therapeutic applications. As cilia dysfunction is often associated with various diseases, such as polycystic kidney disease and retinal degeneration, KIAA0586/TALPID3 could be a potential target for drug development. By understanding its structure and activity, researchers can design drugs that can modulate its function and potentially treat these diseases.

Conclusion

In conclusion, Recombinant Human KIAA0586/TALPID3 Protein is a versatile protein with a unique structure and essential role in various cellular processes. Its study has provided valuable insights into the development and maintenance of tissues and organs, as well as potential therapeutic applications. Further research on this protein is required to fully understand its complex functions and potential in the treatment of various diseases.

Recombinant Human KIAA0586/TALPID3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KIAA0586/TALPID3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products