Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O15503
Molecular weight:
22.29 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Pro2–Leu85
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11733-100
Uniprot ID O15503
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLL
Molecular weight 22.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Leu85
Aliases /Synonyms Insulin-induced gene 1 protein, INSIG1, INSIG-1
Reference ARO-P11733
Note For research use only.
Molecular Constructor
Pro2–Leu85
Product name ARO-P11733-1MG
Uniprot ID O15503
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLL
Molecular weight 22.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Leu85
Aliases /Synonyms Insulin-induced gene 1 protein, INSIG1, INSIG-1
Reference ARO-P11733
Note For research use only.
Molecular Constructor
Pro2–Leu85
Product name ARO-P11733-50
Uniprot ID O15503
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLL
Molecular weight 22.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Leu85
Aliases /Synonyms Insulin-induced gene 1 protein, INSIG1, INSIG-1
Reference ARO-P11733
Note For research use only.
Molecular Constructor
Pro2–Leu85

Introduction

Recombinant Human INSIG1 Protein, also known as Insulin-induced gene 1 protein, is a protein that plays a crucial role in regulating cholesterol synthesis in the body. This protein is encoded by the INSIG1 gene and is found in both humans and other mammalian species. In this article, we will explore the structure, activity, and applications of Recombinant Human INSIG1 Protein.

Structure of Recombinant Human INSIG1 Protein

The INSIG1 gene is located on chromosome 7 and consists of 6 exons that span over 6.5 kilobases. The protein itself is composed of 267 amino acids and has a molecular weight of approximately 30 kDa. It contains a transmembrane domain and a cytosolic domain, both of which play a crucial role in its function.

Recombinant Human INSIG1 Protein is produced in the laboratory by cloning the INSIG1 gene into a suitable expression vector and expressing it in a host organism, typically E. coli or yeast. The resulting protein is then purified using various techniques, such as chromatography, to obtain a highly pure and active form of the protein.

Activity of Recombinant Human INSIG1 Protein

The main function of INSIG1 protein is to regulate cholesterol synthesis in the body. It does so by interacting with two key enzymes involved in cholesterol biosynthesis: HMG-CoA reductase and SREBP cleavage-activating protein (SCAP). INSIG1 binds to these enzymes and prevents their activation, thereby inhibiting the production of cholesterol.

Additionally, INSIG1 also plays a role in lipid metabolism and insulin signaling. Studies have shown that it can regulate the expression of genes involved in these processes, further highlighting its importance in maintaining proper metabolic balance in the body.

Applications of Recombinant Human INSIG1 Protein

Due to its role in regulating cholesterol synthesis, Recombinant Human INSIG1 Protein has potential applications in the treatment of hypercholesterolemia and other metabolic disorders. It can be used as a therapeutic agent to lower cholesterol levels in patients with high cholesterol and reduce the risk of cardiovascular diseases.

Furthermore, INSIG1 has also been studied for its potential in cancer treatment. It has been found to inhibit the growth and proliferation of cancer cells, making it a potential target for anti-cancer therapies.

In addition to its therapeutic applications, Recombinant Human INSIG1 Protein is also used in research and development. It can be used to study the mechanisms of cholesterol synthesis and metabolism, as well as to investigate the role of INSIG1 in various diseases and conditions.

Conclusion

In summary, Recombinant Human INSIG1 Protein is a vital protein involved in regulating cholesterol synthesis and metabolism in the body. Its structure, activity, and potential applications make it a valuable tool in both therapeutic and research settings. Further studies on this protein may lead to the development of new treatments for various metabolic disorders and cancer.

Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products