Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL17B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UHF5
Molecular weight:
20.45 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Gln21–Phe180
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL17B, N-His

Product name ARO-P13027-100
Uniprot ID Q9UHF5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCI
Molecular weight 20.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln21-Phe180
Aliases /Synonyms Interleukin-17B, IL20, Cytokine Zcyto7, IL17B, IL-20, Interleukin-20, NIRF, Neuronal interleukin-17-related factor, ZCYTO7, IL-17B
Reference ARO-P13027
Note For research use only.
Molecular Constructor
Gln21–Phe180
Product name ARO-P13027-1MG
Uniprot ID Q9UHF5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCI
Molecular weight 20.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln21-Phe180
Aliases /Synonyms Interleukin-17B, IL20, Cytokine Zcyto7, IL17B, IL-20, Interleukin-20, NIRF, Neuronal interleukin-17-related factor, ZCYTO7, IL-17B
Reference ARO-P13027
Note For research use only.
Molecular Constructor
Gln21–Phe180
Product name ARO-P13027-50
Uniprot ID Q9UHF5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCI
Molecular weight 20.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln21-Phe180
Aliases /Synonyms Interleukin-17B, IL20, Cytokine Zcyto7, IL17B, IL-20, Interleukin-20, NIRF, Neuronal interleukin-17-related factor, ZCYTO7, IL-17B
Reference ARO-P13027
Note For research use only.
Molecular Constructor
Gln21–Phe180

Introduction to Recombinant Human IL17B

Recombinant Human IL17B is a protein that is produced through genetic engineering techniques in order to replicate the natural form of the protein found in humans. This protein belongs to the interleukin-17 (IL-17) family, which is a group of cytokines that play a crucial role in the immune response and inflammation. In this article, we will explore the structure, activity, and applications of Recombinant Human IL17B.

Structure of Recombinant Human IL17B

Recombinant Human IL17B is a small protein consisting of 136 amino acids with a molecular weight of approximately 15 kDa. It is composed of a single polypeptide chain and has a similar structure to other members of the IL-17 family. The protein is characterized by four alpha-helices connected by short loops, forming a compact globular structure.

The gene encoding for Recombinant Human IL17B is located on chromosome 5 and is highly conserved among different species, with 97% identity between human and mouse IL17B. This high level of conservation suggests that the protein plays an important role in various biological processes.

Activity of Recombinant Human IL17B

Recombinant Human IL17B is a pro-inflammatory cytokine that is primarily produced by T helper 17 (Th17) cells and natural killer (NK) cells. It exerts its activity by binding to the IL-17 receptor B (IL-17RB) and activating downstream signaling pathways.

One of the main functions of Recombinant Human IL17B is to regulate the immune response by promoting the production of other pro-inflammatory cytokines, such as IL-6, IL-8, and TNF-α. It also plays a crucial role in the recruitment and activation of immune cells, including neutrophils and macrophages, to the site of inflammation.

Besides its role in the immune system, Recombinant Human IL17B has been shown to have a direct effect on various cell types, including epithelial cells, fibroblasts, and endothelial cells. It can induce the production of chemokines and growth factors, which contribute to tissue repair and angiogenesis.

Applications of Recombinant Human IL17B

Due to its role in inflammation and tissue repair, Recombinant Human IL17B has been studied for its potential therapeutic applications. One of the most promising areas of research is in the treatment of autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and psoriasis. These diseases are characterized by an overactive immune response, and Recombinant Human IL17B has been shown to regulate this response and reduce inflammation.

Another potential application of Recombinant Human IL17B is in the treatment of cancer. Studies have shown that the protein can inhibit the growth and proliferation of cancer cells, making it a potential target for cancer therapy. It has also been shown to enhance the anti-tumor activity of other cytokines, such as IL-2 and IL-12, making it a promising candidate for combination therapy.

Furthermore, Recombinant Human IL17B has been studied for its potential use in tissue regeneration and wound healing. Its ability to promote the production of growth factors and stimulate angiogenesis makes it a potential treatment for chronic wounds and tissue damage.

Conclusion

In summary, Recombinant Human IL17B is a small but powerful protein that plays a crucial role in the immune response and inflammation. Its structure, activity, and potential applications make it a promising candidate for the treatment of various diseases, including autoimmune disorders and cancer. Further research on this protein may lead to the development of new therapies and treatments for these conditions.

Recombinant Human IL17B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL17B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products