Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ID3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q02535
Molecular weight:
21.69 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Lys2–Glu86
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ID3 Protein, N-His-SUMO

Product name ARO-P11965-100
Uniprot ID Q02535
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAE
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys2-Glu86
Aliases /Synonyms ID3, 1R21, BHLHB25, bHLHb25, Class B basic helix-loop-helix protein 25, Inhibitor of differentiation 3, DNA-binding protein inhibitor ID-3, Inhibitor of DNA binding 3, HEIR1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21
Reference ARO-P11965
Note For research use only.
Molecular Constructor
Lys2–Glu86
Product name ARO-P11965-1MG
Uniprot ID Q02535
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAE
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys2-Glu86
Aliases /Synonyms ID3, 1R21, BHLHB25, bHLHb25, Class B basic helix-loop-helix protein 25, Inhibitor of differentiation 3, DNA-binding protein inhibitor ID-3, Inhibitor of DNA binding 3, HEIR1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21
Reference ARO-P11965
Note For research use only.
Molecular Constructor
Lys2–Glu86
Product name ARO-P11965-50
Uniprot ID Q02535
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAE
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys2-Glu86
Aliases /Synonyms ID3, 1R21, BHLHB25, bHLHb25, Class B basic helix-loop-helix protein 25, Inhibitor of differentiation 3, DNA-binding protein inhibitor ID-3, Inhibitor of DNA binding 3, HEIR1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21
Reference ARO-P11965
Note For research use only.
Molecular Constructor
Lys2–Glu86

Introduction

Recombinant proteins have revolutionized the field of biotechnology, providing a means to produce large quantities of specific proteins for research, diagnostic, and therapeutic purposes. One such protein is Recombinant Human ID3 Protein, a member of the inhibitor of differentiation (ID) family. In this article, we will explore the structure, activity, and application of this important recombinant protein.

Structure of Recombinant Human ID3 Protein

Recombinant Human ID3 Protein is a 17 kDa protein composed of 152 amino acids. It belongs to the ID family, which consists of four members (ID1-4) that play a crucial role in cell differentiation and proliferation. The ID proteins lack a DNA-binding domain, but they can inhibit the activity of basic helix-loop-helix (bHLH) transcription factors by forming inactive heterodimers with them.

The structure of Recombinant Human ID3 Protein is characterized by a highly conserved helix-loop-helix domain, which is responsible for its interaction with bHLH transcription factors. This domain is flanked by N- and C-terminal regions that are less conserved among the ID family members. The N-terminal region is thought to be involved in protein-protein interactions, while the C-terminal region may play a role in regulating the stability of the protein.

Activity of Recombinant Human ID3 Protein

Recombinant Human ID3 Protein is a potent inhibitor of cell differentiation and proliferation. It exerts its activity by binding to bHLH transcription factors and preventing them from binding to DNA and activating gene expression. This inhibition of bHLH transcription factors is crucial for maintaining the undifferentiated state of stem cells and promoting cell proliferation in various tissues.

In addition to its role in regulating cell differentiation and proliferation, Recombinant Human ID3 Protein has been shown to have anti-apoptotic effects, protecting cells from programmed cell death. It has also been implicated in promoting angiogenesis, the formation of new blood vessels, which is essential for tissue growth and repair.

Application of Recombinant Human ID3 Protein

Recombinant Human ID3 Protein has a wide range of applications in both research and medicine. In research, it is commonly used as a tool to study the role of ID proteins in cell differentiation and proliferation. Its ability to inhibit bHLH transcription factors makes it a valuable tool for investigating the downstream effects of these factors on gene expression.

In medicine, Recombinant Human ID3 Protein has potential therapeutic applications. Its ability to promote cell proliferation and angiogenesis makes it a promising candidate for tissue regeneration and wound healing. It has also been shown to have potential anti-cancer effects, as it can inhibit the growth of certain types of cancer cells by preventing their differentiation and promoting their survival.

Furthermore, Recombinant Human ID3 Protein has been used as an antigen in diagnostic tests for various diseases. Its ability to induce an immune response makes it a useful tool for detecting the presence of specific antibodies in patient samples, aiding in the diagnosis of diseases such as cancer and autoimmune disorders.

Conclusion

In summary, Recombinant Human ID3 Protein is a 17 kDa protein with a highly conserved helix-loop-helix domain and is a member of the ID family. It exerts its activity by inhibiting bHLH transcription factors, and has important roles in cell differentiation, proliferation, and survival. Its wide range of applications in research and medicine make it a valuable tool for understanding the complex processes of cell regulation and for developing potential therapeutics and diagnostic tests.

Recombinant Human ID3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ID3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products