Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human HTR2C Protein, N-His-KSI

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P28335
Molecular weight:
24.62 kDa

Original price was: €285.00.Current price is: €228.00.

50ug 20% OFF + 228 loyalty points
His-KSI Leu236–Lys311
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Human HTR2C Protein, N-His-KSI

Recombinant Human HTR2C Protein, N-His-KSI

Product name ARO-P16148-100
Uniprot ID P28335
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASK
Molecular weight 24.62 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu236-Lys311
Aliases /Synonyms 5-hydroxytryptamine receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine receptor 1C, 5-HT-1C, 5-HT1C, Serotonin receptor 2C, HTR2C, HTR1C
Reference ARO-P16148
Note For research use only.
Molecular Constructor
His-KSI Leu236–Lys311
Product name ARO-P16148-1MG
Uniprot ID P28335
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASK
Molecular weight 24.62 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu236-Lys311
Aliases /Synonyms 5-hydroxytryptamine receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine receptor 1C, 5-HT-1C, 5-HT1C, Serotonin receptor 2C, HTR2C, HTR1C
Reference ARO-P16148
Note For research use only.
Molecular Constructor
His-KSI Leu236–Lys311
Product name ARO-P16148-50
Uniprot ID P28335
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASK
Molecular weight 24.62 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu236-Lys311
Aliases /Synonyms 5-hydroxytryptamine receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine receptor 1C, 5-HT-1C, 5-HT1C, Serotonin receptor 2C, HTR2C, HTR1C
Reference ARO-P16148
Note For research use only.
Molecular Constructor
His-KSI Leu236–Lys311

SDS-PAGE for Recombinant Human HTR2C Protein, N-His-KSI

SDS-PAGE for Recombinant Human HTR2C Protein, N-His-KSI

Recombinant Human HTR2C Protein, N-His-KSI, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human HTR2C Protein, N-His-KSI”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products