Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HOXB9 Protein, N-His-KSI

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P17482
Molecular weight:
43.69 kDa

Original price was: €267.00.Current price is: €228.00.

50ug 15% OFF + 228 loyalty points
His-KSI Ser2–Glu250
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HOXB9 Protein, N-His-KSI

Product name ARO-P16135-100
Uniprot ID P17482
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Molecular weight 43.69 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Glu250
Aliases /Synonyms Homeobox protein Hox-B9, Homeobox protein Hox-2.5, Homeobox protein Hox-2E, HOXB9, HOX2E
Reference ARO-P16135
Note For research use only.
Molecular Constructor
His-KSI Ser2–Glu250
Product name ARO-P16135-1MG
Uniprot ID P17482
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Molecular weight 43.69 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Glu250
Aliases /Synonyms Homeobox protein Hox-B9, Homeobox protein Hox-2.5, Homeobox protein Hox-2E, HOXB9, HOX2E
Reference ARO-P16135
Note For research use only.
Molecular Constructor
His-KSI Ser2–Glu250
Product name ARO-P16135-50
Uniprot ID P17482
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Molecular weight 43.69 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Glu250
Aliases /Synonyms Homeobox protein Hox-B9, Homeobox protein Hox-2.5, Homeobox protein Hox-2E, HOXB9, HOX2E
Reference ARO-P16135
Note For research use only.
Molecular Constructor
His-KSI Ser2–Glu250

SDS-PAGE for Recombinant Human HOXB9 Protein, N-His-KSI

SDS-PAGE for Recombinant Human HOXB9 Protein, N-His-KSI

Recombinant Human HOXB9 Protein, N-His-KSI, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human HOXB9 Protein, N-His-KSI”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products