Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HK3, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52790
Molecular weight:
27.52 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
His Tyr673–Ser903
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HK3, N-His

Product name ARO-P13648-100
Uniprot ID P52790
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGS
Molecular weight 27.52 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr673-Ser903
Aliases /Synonyms Hexokinase-C, Hexokinase type III, HK3, Hexokinase-3, HK III
Reference ARO-P13648
Note For research use only.
Molecular Constructor
His Tyr673–Ser903
Product name ARO-P13648-1MG
Uniprot ID P52790
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGS
Molecular weight 27.52 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr673-Ser903
Aliases /Synonyms Hexokinase-C, Hexokinase type III, HK3, Hexokinase-3, HK III
Reference ARO-P13648
Note For research use only.
Molecular Constructor
His Tyr673–Ser903
Product name ARO-P13648-50
Uniprot ID P52790
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGS
Molecular weight 27.52 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr673-Ser903
Aliases /Synonyms Hexokinase-C, Hexokinase type III, HK3, Hexokinase-3, HK III
Reference ARO-P13648
Note For research use only.
Molecular Constructor
His Tyr673–Ser903

Introduction to Recombinant Human HK3

Recombinant Human HK3 (rhHK3) is a recombinant protein that has gained significant attention in the field of biotechnology due to its potential applications in various industries. It is a human isoform of hexokinase, an enzyme involved in the first step of glucose metabolism. In this article, we will delve into the structure, activity, and application of rhHK3.

Structure of Recombinant Human HK3

The recombinant human HK3 is a protein that is produced through genetic engineering techniques, specifically through the insertion of the human HK3 gene into a suitable expression vector. This results in the production of a protein that is identical to the native human HK3 in terms of amino acid sequence and structure.

The structure of rhHK3 is composed of 917 amino acids with a molecular weight of approximately 102 kDa. It is a homodimeric protein, meaning it is composed of two identical subunits, each containing a catalytic domain and a regulatory domain. The catalytic domain is responsible for the enzymatic activity of HK3, while the regulatory domain helps in the binding of substrates and allosteric regulation of the enzyme.

Activity of Recombinant Human HK3

The primary function of HK3 is to convert glucose into glucose-6-phosphate, which is a crucial step in glucose metabolism. This activity is essential for the production of energy in cells, as well as for the biosynthesis of various cellular components. The recombinant human HK3 has been shown to have similar activity to the native enzyme, making it a suitable alternative for various applications.

One of the unique features of rhHK3 is its high specificity towards glucose as a substrate. This specificity is crucial in preventing the conversion of other sugars, such as fructose, into glucose-6-phosphate, which can lead to metabolic disorders. Additionally, rhHK3 has been shown to have a higher affinity for glucose compared to other hexokinase isoforms, making it a more efficient enzyme for glucose metabolism.

Application of Recombinant Human HK3

The recombinant human HK3 has a wide range of potential applications in various industries, including biotechnology, pharmaceuticals, and food production.

In the biotechnology industry, rhHK3 is used for the production of glucose-6-phosphate, which is an essential precursor for the synthesis of various biomolecules, such as nucleotides and amino acids. It can also be used in the production of biofuels, as the conversion of glucose into glucose-6-phosphate is a crucial step in the fermentation process.

In the pharmaceutical industry, rhHK3 has shown promise as a potential therapeutic target for the treatment of metabolic disorders, such as diabetes and obesity. Its high specificity towards glucose makes it an ideal candidate for the regulation of glucose levels in the body.

In the food production industry, rhHK3 can be used for the production of high-fructose corn syrup, a common sweetener used in various food and beverage products. Its high specificity towards glucose ensures the production of a pure product without the presence of other sugars.

Conclusion

In conclusion, recombinant human HK3 is a promising protein with a wide range of potential applications. Its structure, activity, and specificity towards glucose make it a valuable enzyme in various industries. Further research and development of rhHK3 may lead to more innovative and beneficial applications in the future.

Recombinant Human HK3, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HK3, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products