Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HDAC1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13547
Molecular weight:
57.26 kDa

Original price was: €245.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Met1–Ala482
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HDAC1 Protein, N-His

Product name ARO-P10411-100
Uniprot ID Q13547
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Molecular weight 57.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala482
Aliases /Synonyms Histone deacetylase 1, HDAC1, RPD3L1, HD1
Reference ARO-P10411
Note For research use only.
Molecular Constructor
Met1–Ala482
Product name ARO-P10411-1MG
Uniprot ID Q13547
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Molecular weight 57.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala482
Aliases /Synonyms Histone deacetylase 1, HDAC1, RPD3L1, HD1
Reference ARO-P10411
Note For research use only.
Molecular Constructor
Met1–Ala482
Product name ARO-P10411-50
Uniprot ID Q13547
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Molecular weight 57.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala482
Aliases /Synonyms Histone deacetylase 1, HDAC1, RPD3L1, HD1
Reference ARO-P10411
Note For research use only.
Molecular Constructor
Met1–Ala482

The Structure of Recombinant Human HDAC1 Protein

Recombinant Human HDAC1 Protein is a highly purified form of the human histone deacetylase 1 enzyme, which is encoded by the HDAC1 gene. This protein is a member of the class I histone deacetylase family and is composed of 482 amino acids, with a molecular weight of approximately 55 kDa. It contains a catalytic domain, a zinc-binding domain, and several other conserved domains that are important for its function.

The Activity of Recombinant Human HDAC1 Protein

HDAC1 is a key enzyme involved in the regulation of gene expression by removing acetyl groups from lysine residues on histone proteins. This process, known as deacetylation, results in a more compact and transcriptionally inactive chromatin structure. HDAC1 has been shown to play a critical role in a variety of cellular processes, including cell cycle regulation, differentiation, and apoptosis.

The activity of Recombinant Human HDAC1 Protein has been extensively studied in vitro and has been shown to exhibit similar enzymatic activity to the endogenous protein. It is able to efficiently deacetylate histone substrates and has a broad substrate specificity, targeting both histone and non-histone proteins. This activity is dependent on the presence of zinc ions, which are coordinated by the zinc-binding domain of the protein.

Applications of Recombinant Human HDAC1 Protein

Recombinant Human HDAC1 Protein has a wide range of applications in both basic research and drug discovery. Its ability to regulate gene expression makes it a valuable tool for studying epigenetic mechanisms and their role in various diseases. It has been implicated in the development of cancer, neurodegenerative disorders, and inflammatory diseases, making it a potential therapeutic target.

In addition, Recombinant Human HDAC1 Protein has been used in the development of HDAC inhibitors, which are a class of drugs that target HDAC enzymes. These inhibitors have shown promising results in clinical trials for the treatment of various cancers and other diseases. Recombinant HDAC1 Protein is also used in high-throughput screening assays to identify potential HDAC inhibitors and study their mechanism of action.

Antigenicity of Recombinant Human HDAC1 Protein

Recombinant Human HDAC1 Protein is highly antigenic, meaning it has the ability to induce an immune response in the body. This property makes it a useful antigen for the production of antibodies and for use in immunological assays. Antibodies against HDAC1 can be used to study the expression and localization of the protein in different tissues and cell types.

In addition, Recombinant Human HDAC1 Protein has been used as an antigen in vaccine development. It has been shown to elicit a strong immune response and has the potential to be used in the development of vaccines against diseases such as cancer and infectious diseases.

Conclusion

Recombinant Human HDAC1 Protein is a valuable tool for studying epigenetic mechanisms and their role in various diseases. Its structure, activity, and antigenicity make it a versatile protein with a wide range of applications in basic research and drug discovery. As our understanding of the role of HDAC1 in disease continues to grow, the use of Recombinant Human HDAC1 Protein will undoubtedly play a crucial role in advancing our knowledge and developing new therapies.

Recombinant Human HDAC1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HDAC1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products