Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human H2AJ, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BTM1
Molecular weight:
16.11 kDa

Original price was: €290.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Gly3–Lys129
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human H2AJ, N-His

Product name ARO-P13133-100
Uniprot ID Q9BTM1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Molecular weight 16.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly3-Lys129
Aliases /Synonyms Histone H2A.J, H2AFJ, H2a/j, H2AJ
Reference ARO-P13133
Note For research use only.
Molecular Constructor
Gly3–Lys129
Product name ARO-P13133-1MG
Uniprot ID Q9BTM1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Molecular weight 16.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly3-Lys129
Aliases /Synonyms Histone H2A.J, H2AFJ, H2a/j, H2AJ
Reference ARO-P13133
Note For research use only.
Molecular Constructor
Gly3–Lys129
Product name ARO-P13133-50
Uniprot ID Q9BTM1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Molecular weight 16.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly3-Lys129
Aliases /Synonyms Histone H2A.J, H2AFJ, H2a/j, H2AJ
Reference ARO-P13133
Note For research use only.
Molecular Constructor
Gly3–Lys129

Introduction

Recombinant Human H2AJ is a protein that plays a crucial role in regulating gene expression and maintaining the structure of chromatin. It is a variant of the histone protein H2A, which is a key component of the nucleosome, the basic unit of chromatin. In this article, we will explore the structure, activity, and application of Recombinant Human H2AJ.

Structure of Recombinant Human H2AJ

Recombinant Human H2AJ is a 14-kDa protein consisting of 128 amino acids. It has a highly conserved structure, with a central globular domain and a long N-terminal tail. The globular domain is responsible for binding to DNA and forming the nucleosome, while the N-terminal tail contains post-translational modifications that regulate gene expression.

Post-Translational Modifications

The N-terminal tail of Recombinant Human H2AJ can undergo various post-translational modifications, including acetylation, methylation, phosphorylation, and ubiquitination. These modifications can alter the chromatin structure and regulate the accessibility of DNA to transcription factors and other regulatory proteins.

Activity of Recombinant Human H2AJ

Recombinant Human H2AJ has multiple functions in the cell, including:

  • Nucleosome Formation: As a variant of H2A, Recombinant Human H2AJ is essential for the formation of the nucleosome, which helps to package DNA into a compact structure and regulate gene expression.
  • Gene Expression Regulation: The post-translational modifications on the N-terminal tail of Recombinant Human H2AJ can affect the binding of transcription factors and other regulatory proteins, thereby regulating gene expression.
  • DNA Damage Response: Recombinant Human H2AJ is involved in the cellular response to DNA damage, including DNA repair and cell cycle checkpoint activation.

Role in Cancer

Aberrant expression and function of Recombinant Human H2AJ have been linked to various types of cancer. For example, overexpression of H2AJ has been observed in breast cancer, and its depletion has been shown to inhibit tumor growth in vitro. Additionally, mutations in the gene encoding H2AJ have been identified in certain types of lymphomas and leukemias.

Application of Recombinant Human H2AJ

Recombinant Human H2AJ has various applications in both research and clinical settings. Some of the most common applications include:

  • Chromatin Immunoprecipitation (ChIP): Recombinant Human H2AJ can be used in ChIP assays to study the binding of transcription factors and other regulatory proteins to specific regions of DNA.
  • Epigenetics Research: The post-translational modifications on the N-terminal tail of Recombinant Human H2AJ play a crucial role in epigenetic regulation, making it a valuable tool for studying epigenetic mechanisms.
  • Cancer Research: As mentioned earlier, Recombinant Human H2AJ has been implicated in cancer, making it a potential target for cancer therapy. Additionally, it can be used in cancer diagnostics to detect aberrant H2AJ expression in patient samples.

Limitations

Although Recombinant Human H2AJ has many applications, it is

Recombinant Human H2AJ, N-His

There are no reviews yet.

Be the first to review “Recombinant Human H2AJ, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products