Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPR183 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P32249
Molecular weight:
17.91 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Lys313–Lys361
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPR183 Protein, N-His-SUMO

Product name ARO-P10781-100
Uniprot ID P32249
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYKRKVMRMLKRQVSVSISSAVKSAPEENSREMTETQMMIHSKSSNGK
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys313-Lys361
Aliases /Synonyms GPR183, G-protein coupled receptor 183, hEBI2, Epstein-Barr virus-induced G-protein coupled receptor 2, EBI2, EBV-induced G-protein coupled receptor 2
Reference ARO-P10781
Note For research use only.
Molecular Constructor
Lys313–Lys361
Product name ARO-P10781-1MG
Uniprot ID P32249
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYKRKVMRMLKRQVSVSISSAVKSAPEENSREMTETQMMIHSKSSNGK
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys313-Lys361
Aliases /Synonyms GPR183, G-protein coupled receptor 183, hEBI2, Epstein-Barr virus-induced G-protein coupled receptor 2, EBI2, EBV-induced G-protein coupled receptor 2
Reference ARO-P10781
Note For research use only.
Molecular Constructor
Lys313–Lys361
Product name ARO-P10781-50
Uniprot ID P32249
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYKRKVMRMLKRQVSVSISSAVKSAPEENSREMTETQMMIHSKSSNGK
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys313-Lys361
Aliases /Synonyms GPR183, G-protein coupled receptor 183, hEBI2, Epstein-Barr virus-induced G-protein coupled receptor 2, EBI2, EBV-induced G-protein coupled receptor 2
Reference ARO-P10781
Note For research use only.
Molecular Constructor
Lys313–Lys361

Introduction
Recombinant human GPR183 protein, also known as Epstein-Barr virus-induced G protein-coupled receptor 2 (EBI2), is a member of the G protein-coupled receptor (GPCR) family. It is encoded by the GPR183 gene located on chromosome 13q32.3. GPR183 is expressed in various tissues, including lymphoid organs, spleen, thymus, and peripheral blood leukocytes. This protein plays a crucial role in the immune system and has been linked to various diseases, making it a potential therapeutic target.

Structure of Recombinant Human GPR183 Protein
The human GPR183 protein is a seven-transmembrane domain protein with an extracellular N-terminus and an intracellular C-terminus. It has a molecular weight of approximately 40 kDa and is composed of 349 amino acids. The crystal structure of GPR183 has been determined, revealing a helical bundle structure with a ligand-binding pocket located between the transmembrane helices. The extracellular loops of GPR183 contain several glycosylation sites, which may play a role in ligand binding and receptor activation.

Activity of Recombinant Human GPR183 Protein
GPR183 is activated by a variety of ligands, including oxysterols, bile acids, and chemokines. Binding of these ligands to the receptor leads to the activation of downstream signaling pathways, including the Gαi and Gαq pathways. Activation of GPR183 results in the mobilization of intracellular calcium, activation of protein kinase C, and phosphorylation of extracellular signal-regulated kinases (ERKs). These signaling pathways are involved in the regulation of various cellular processes, including cell proliferation, migration, and differentiation.

Application of Recombinant Human GPR183 Protein
The role of GPR183 in the immune system has been extensively studied, and it has been shown to play a critical role in the migration and activation of immune cells. GPR183 is highly expressed in B cells, T cells, and dendritic cells, and its activation has been linked to the regulation of immune response and inflammation. The use of recombinant human GPR183 protein has been explored in various research areas, including immunology, oncology, and neurology.

In immunology, GPR183 has been implicated in the regulation of B cell migration and antibody production. Recombinant human GPR183 protein has been used to study the role of this receptor in B cell activation and differentiation. It has also been shown to play a role in the regulation of T cell migration and cytokine production. The use of recombinant GPR183 protein has provided valuable insights into the mechanisms underlying immune cell function and has the potential to aid in the development of new immunotherapies.

In oncology, GPR183 has been linked to the development and progression of various cancers, including breast cancer, melanoma, and lymphoma. Recombinant human GPR183 protein has been used to study the role of this receptor in tumor growth and metastasis. It has also been explored as a potential therapeutic target for the treatment of cancer. Additionally, GPR183 has been shown to play a role in neuroinflammation and neurodegenerative diseases, making it a potential target for the treatment of neurological disorders.

Conclusion
Recombinant human GPR183 protein is a crucial player in the immune system and has been linked to various diseases, making it a potential therapeutic target. Its structure, activity, and application have been extensively studied, providing valuable insights into its role in the regulation of immune response, cancer, and neuroinflammation. Further research on GPR183 and the use of recombinant protein may lead to the development of novel treatments for immune-related disorders and other diseases.

Recombinant Human GPR183 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human GPR183 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products