Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GDI2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P50395
Molecular weight:
52.83 kDa

Original price was: €299.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Met1–Asp445
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GDI2 Protein, N-His

Product name ARO-P12395-100
Uniprot ID P50395
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Molecular weight 52.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp445
Aliases /Synonyms Guanosine diphosphate dissociation inhibitor 2, GDI-2, Rab GDP dissociation inhibitor beta, Rab GDI beta, RABGDIB, GDI2
Reference ARO-P12395
Note For research use only.
Molecular Constructor
Met1–Asp445
Product name ARO-P12395-1MG
Uniprot ID P50395
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Molecular weight 52.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp445
Aliases /Synonyms Guanosine diphosphate dissociation inhibitor 2, GDI-2, Rab GDP dissociation inhibitor beta, Rab GDI beta, RABGDIB, GDI2
Reference ARO-P12395
Note For research use only.
Molecular Constructor
Met1–Asp445
Product name ARO-P12395-50
Uniprot ID P50395
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Molecular weight 52.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp445
Aliases /Synonyms Guanosine diphosphate dissociation inhibitor 2, GDI-2, Rab GDP dissociation inhibitor beta, Rab GDI beta, RABGDIB, GDI2
Reference ARO-P12395
Note For research use only.
Molecular Constructor
Met1–Asp445

Introduction

Recombinant Human GDI2 Protein, also known as Guanine Nucleotide Dissociation Inhibitor 2, is a protein that plays a crucial role in regulating the activity of small GTPases. This protein is encoded by the GDI2 gene and is a member of the GDI family. GDI2 is involved in various cellular processes such as cell signaling, cytoskeletal organization, and membrane trafficking. In this article, we will discuss the structure, activity, and applications of Recombinant Human GDI2 Protein.

Structure of Recombinant Human GDI2 Protein

Recombinant Human GDI2 Protein is a 46 kDa protein that consists of 442 amino acids. It contains two domains, an N-terminal domain and a C-terminal domain, connected by a flexible linker. The N-terminal domain is responsible for binding to small GTPases, while the C-terminal domain is involved in regulating the activity of these GTPases. The structure of GDI2 is highly conserved among different species, indicating its importance in cellular function.

Activity of Recombinant Human GDI2 Protein

The main function of Recombinant Human GDI2 Protein is to regulate the activity of small GTPases. GTPases are enzymes that play a critical role in various cellular processes, including cell growth, differentiation, and movement. GDI2 acts as a molecular switch by binding to the inactive form of GTPases and preventing their activation. This binding also prevents the release of GDP (guanosine diphosphate) from GTPases, which is necessary for their activation. Thus, GDI2 inhibits the activity of GTPases and maintains them in an inactive state.

Apart from regulating GTPase activity, GDI2 also plays a role in membrane trafficking. It has been shown to interact with various membrane proteins and regulate their transport within the cell. GDI2 also plays a role in cell signaling by modulating the activity of signaling molecules such as Ras and Rho.

Applications of Recombinant Human GDI2 Protein

Recombinant Human GDI2 Protein has various applications in the field of cell biology and biotechnology. One of the major applications of GDI2 is in the study of GTPase signaling pathways. Recombinant GDI2 can be used to study the regulation of GTPase activity and its role in different cellular processes. It can also be used to investigate the effects of mutations in the GDI2 gene on protein structure and function.

Another potential application of Recombinant Human GDI2 Protein is in the development of therapeutics. GTPases have been implicated in various diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. As GDI2 regulates the activity of GTPases, it can be targeted for the development of drugs that can modulate GTPase activity and treat these diseases.

Moreover, Recombinant Human GDI2 Protein can also be used in the production of vaccines. GDI2 has been identified as an antigen in several infectious diseases, including tuberculosis and malaria. Recombinant GDI2 can be used to develop vaccines that can induce an immune response against these diseases.

Conclusion

In summary, Recombinant Human GDI2 Protein is a crucial protein involved in regulating the activity of small GTPases. Its structure, consisting of two domains, allows it to bind to and inhibit the activity of GTPases. GDI2 has various applications in cell biology and biotechnology, including the study of GTPase signaling pathways, development of therapeutics, and production of vaccines. Further research on this protein may uncover new roles and applications, making it an important area of study in the field of molecular biology.

Recombinant Human GDI2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GDI2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products