Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human GCHFR Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P30047
Molecular weight:
37.75 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
GST Pro2–Glu84 His
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Human GCHFR Protein, N-GST & C-His

Recombinant Human GCHFR Protein, N-GST & C-His

Product name ARO-P16152-100
Uniprot ID P30047
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Molecular weight 37.75 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Glu84
Aliases /Synonyms GTP cyclohydrolase 1 feedback regulatory protein, GFRP, GTP cyclohydrolase I feedback regulatory protein, p35, GCHFR, GFRP
Reference ARO-P16152
Note For research use only.
Molecular Constructor
GST Pro2–Glu84 His
Product name ARO-P16152-1MG
Uniprot ID P30047
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Molecular weight 37.75 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Glu84
Aliases /Synonyms GTP cyclohydrolase 1 feedback regulatory protein, GFRP, GTP cyclohydrolase I feedback regulatory protein, p35, GCHFR, GFRP
Reference ARO-P16152
Note For research use only.
Molecular Constructor
GST Pro2–Glu84 His
Product name ARO-P16152-50
Uniprot ID P30047
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Molecular weight 37.75 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Glu84
Aliases /Synonyms GTP cyclohydrolase 1 feedback regulatory protein, GFRP, GTP cyclohydrolase I feedback regulatory protein, p35, GCHFR, GFRP
Reference ARO-P16152
Note For research use only.
Molecular Constructor
GST Pro2–Glu84 His

SDS-PAGE for Recombinant Human GCHFR Protein, N-GST & C-His

SDS-PAGE for Recombinant Human GCHFR Protein, N-GST & C-His

Recombinant Human GCHFR Protein, N-GST & C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human GCHFR Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products