Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GCDH, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92947
Molecular weight:
20.66 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Glu270–Lys438
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GCDH, N-His

Product name ARO-P13195-100
Uniprot ID Q92947
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK
Molecular weight 20.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu270-Lys438
Aliases /Synonyms Glutaryl-CoA dehydrogenase, mitochondrial, GCD, GCDH
Reference ARO-P13195
Note For research use only.
Molecular Constructor
Glu270–Lys438
Product name ARO-P13195-1MG
Uniprot ID Q92947
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK
Molecular weight 20.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu270-Lys438
Aliases /Synonyms Glutaryl-CoA dehydrogenase, mitochondrial, GCD, GCDH
Reference ARO-P13195
Note For research use only.
Molecular Constructor
Glu270–Lys438
Product name ARO-P13195-50
Uniprot ID Q92947
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK
Molecular weight 20.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu270-Lys438
Aliases /Synonyms Glutaryl-CoA dehydrogenase, mitochondrial, GCD, GCDH
Reference ARO-P13195
Note For research use only.
Molecular Constructor
Glu270–Lys438

Recombinant Human GCDH: Structure, Activity, and Application

Introduction

Recombinant human GCDH (glutaryl-CoA dehydrogenase) is a protein that plays a crucial role in the metabolism of amino acids. It is a key enzyme in the catabolic pathway of lysine, hydroxylysine, and tryptophan. This protein is encoded by the GCDH gene and is essential for the proper functioning of the body. In this article, we will discuss the structure, activity, and application of recombinant human GCDH.

Structure of Recombinant Human GCDH

Recombinant human GCDH is a homotetrameric protein, meaning it is composed of four identical subunits. Each subunit has a molecular weight of approximately 45 kDa. The primary structure of GCDH consists of 399 amino acids and has a conserved NAD+ binding domain. The protein also contains a conserved glycine-rich loop, which is involved in the binding of the substrate. The tertiary structure of GCDH is composed of two domains: an N-terminal domain and a C-terminal domain. The N-terminal domain contains the active site, while the C-terminal domain is responsible for the tetramerization of the protein.

Activity of Recombinant Human GCDH

The main function of recombinant human GCDH is to catalyze the conversion of glutaryl-CoA to crotonyl-CoA in the presence of NAD+. This reaction is a crucial step in the catabolism of lysine, hydroxylysine, and tryptophan. GCDH plays a crucial role in maintaining the balance of these amino acids in the body. Any mutations or deficiencies in the GCDH gene can lead to a condition called glutaric aciduria type 1, which can cause severe neurological damage.

Mechanism of Action

The mechanism of action of recombinant human GCDH involves the binding of the substrate, glutaryl-CoA, to the active site of the protein. This binding triggers a conformational change in the protein, leading to the transfer of a hydride ion from the substrate to the NAD+ cofactor. This results in the formation of crotonyl-CoA and NADH. The crotonyl-CoA can then enter the next step of the catabolic pathway, while the NADH is used in other metabolic processes.

Application of Recombinant Human GCDH

Recombinant human GCDH has various applications in the field of biotechnology and medicine. One of the most significant applications is its use in the diagnosis of glutaric aciduria type 1. The activity of GCDH can be measured in blood or urine samples to detect any abnormalities in the catabolic pathway of lysine, hydroxylysine, and tryptophan. This can aid in the early detection and treatment of the disease.

Another application of recombinant human GCDH is in the production of enzymes for industrial use. The protein has been successfully expressed in various host systems, including bacteria, yeast, and insect cells. This allows for the large-scale production of GCDH, which can then be used in the production of various chemicals and pharmaceuticals.

Recombinant Protein Production

Recombinant human GCDH is produced using genetic engineering techniques. The GCDH gene is cloned into a suitable expression vector and then introduced into a host cell. The host cell then produces large quantities of the recombinant protein, which can be purified and used for various applications.

Conclusion

Recombinant human GCDH is a crucial enzyme involved in the metabolism of amino acids. Its structure, activity,

Recombinant Human GCDH, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GCDH, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products