Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GAP43 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P17677
Molecular weight:
17.84 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Asn14–Ala62
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GAP43 Protein, N-His-SUMO

Product name ARO-P10794-100
Uniprot ID P17677
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAA
Molecular weight 17.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn14-Ala62
Aliases /Synonyms Neural phosphoprotein B-50, pp46, Neuromodulin, Axonal membrane protein GAP-43, GAP43, Growth-associated protein 43
Reference ARO-P10794
Note For research use only.
Molecular Constructor
Asn14–Ala62
Product name ARO-P10794-1MG
Uniprot ID P17677
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAA
Molecular weight 17.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn14-Ala62
Aliases /Synonyms Neural phosphoprotein B-50, pp46, Neuromodulin, Axonal membrane protein GAP-43, GAP43, Growth-associated protein 43
Reference ARO-P10794
Note For research use only.
Molecular Constructor
Asn14–Ala62
Product name ARO-P10794-50
Uniprot ID P17677
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAA
Molecular weight 17.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn14-Ala62
Aliases /Synonyms Neural phosphoprotein B-50, pp46, Neuromodulin, Axonal membrane protein GAP-43, GAP43, Growth-associated protein 43
Reference ARO-P10794
Note For research use only.
Molecular Constructor
Asn14–Ala62

Introduction

Recombinant Human GAP43 Protein, also known as Growth-Associated Protein 43, is a highly conserved neuronal protein that plays a crucial role in the development and regeneration of the nervous system. This protein is encoded by the GAP43 gene and is found in various species including humans, mice, and rats. Recombinant Human GAP43 Protein is widely used in research and therapeutic applications due to its unique structure and activity.

Structure of Recombinant Human GAP43 Protein

Recombinant Human GAP43 Protein is a small cytosolic protein with a molecular weight of approximately 43 kDa. It is composed of 246 amino acids and has a characteristic structure consisting of four distinct domains: an N-terminal domain, a central proline-rich domain, a linker region, and a C-terminal domain.

The N-terminal domain of Recombinant Human GAP43 Protein is rich in basic amino acids and is responsible for its membrane-binding activity. This domain contains a myristoylation site, which allows the protein to attach to the cell membrane and facilitates its localization to the growth cone of developing neurons.

The central proline-rich domain of Recombinant Human GAP43 Protein contains multiple repeats of the amino acid proline, which gives the protein its characteristic flexibility. This domain is essential for the protein’s interaction with other proteins and its ability to regulate cellular processes.

The linker region of Recombinant Human GAP43 Protein connects the N-terminal and central domains and is crucial for maintaining the overall structure and function of the protein.

The C-terminal domain of Recombinant Human GAP43 Protein contains a serine-rich region that is highly phosphorylated and is involved in the regulation of the protein’s activity. This domain also plays a role in the protein’s interaction with other signaling molecules and its localization to specific subcellular compartments.

Activity of Recombinant Human GAP43 Protein

Recombinant Human GAP43 Protein is primarily known for its role in promoting neurite outgrowth and axonal regeneration. It acts as a signaling molecule that regulates various cellular processes, including cell motility, cytoskeletal dynamics, and synaptic plasticity.

One of the key activities of Recombinant Human GAP43 Protein is its ability to promote the formation of new neurites and axons in developing neurons. This is achieved through its membrane-binding activity, which allows the protein to localize to the growth cone of developing neurons and promote their elongation and branching.

Recombinant Human GAP43 Protein also plays a crucial role in the regeneration of damaged axons in the nervous system. It is upregulated in response to injury and helps to guide the growth of new axons towards their target cells. This activity is essential for restoring proper neuronal function and promoting recovery after nerve injury.

In addition to its role in neuronal development and regeneration, Recombinant Human GAP43 Protein is also involved in other cellular processes. It has been shown to regulate cell migration, cell adhesion, and synaptic plasticity, making it a crucial protein in the functioning of the nervous system.

Applications of Recombinant Human GAP43 Protein

Recombinant Human GAP43 Protein has a wide range of applications in both research and therapeutic settings. Its ability to promote neurite outgrowth and axonal regeneration makes it a valuable tool for studying neurodevelopmental processes and investigating potential treatments for nerve injuries.

Recombinant Human GAP43 Protein is also used in the production of diagnostic and therapeutic antibodies. Its unique structure and activity make it an ideal antigen for generating antibodies that can specifically target and bind to the protein. These antibodies can then be used for diagnostic purposes or as potential therapeutics for neurological disorders.

Furthermore, Recombinant Human GAP43 Protein has been investigated as a potential therapeutic for neurological disorders such as Alzheimer’s disease and spinal cord injuries. Its ability to promote neurite outgrowth and axonal regeneration makes it a

Recombinant Human GAP43 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human GAP43 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products