Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FOXC1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q12948
Molecular weight:
22.04 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Ser82–Glu163
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FOXC1 Protein, N-His-SUMO

Product name ARO-P12060-100
Uniprot ID Q12948
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFE
Molecular weight 22.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser82-Glu163
Aliases /Synonyms FKHL7, Forkhead box protein C1, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC3, FREAC-3, FOXC1
Reference ARO-P12060
Note For research use only.
Molecular Constructor
Ser82–Glu163
Product name ARO-P12060-1MG
Uniprot ID Q12948
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFE
Molecular weight 22.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser82-Glu163
Aliases /Synonyms FKHL7, Forkhead box protein C1, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC3, FREAC-3, FOXC1
Reference ARO-P12060
Note For research use only.
Molecular Constructor
Ser82–Glu163
Product name ARO-P12060-50
Uniprot ID Q12948
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFE
Molecular weight 22.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser82-Glu163
Aliases /Synonyms FKHL7, Forkhead box protein C1, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC3, FREAC-3, FOXC1
Reference ARO-P12060
Note For research use only.
Molecular Constructor
Ser82–Glu163

Introduction to Recombinant Human FOXC1 Protein

Recombinant Human FOXC1 Protein is a type of protein that is produced in a laboratory using recombinant DNA technology. This protein belongs to the forkhead box (FOX) family of transcription factors, which are proteins that play a crucial role in the regulation of gene expression. FOXC1 is a transcription factor that is involved in various cellular processes, including embryonic development, cell differentiation, and tissue homeostasis.

Structure of Recombinant Human FOXC1 Protein

Recombinant Human FOXC1 Protein is a 553 amino acid protein with a molecular weight of approximately 60 kDa. It contains a highly conserved DNA-binding domain known as the forkhead domain, which is essential for its transcriptional activity. This domain consists of three alpha-helices and two beta-strands, which form a winged-helix structure that allows FOXC1 to bind to specific DNA sequences.

In addition to the forkhead domain, Recombinant Human FOXC1 Protein also has a C-terminal transactivation domain, which is responsible for activating the transcription of target genes. This domain contains several conserved amino acid motifs, including the LXXLL motif, which interacts with other transcriptional co-regulators to enhance FOXC1’s transcriptional activity.

Activity of Recombinant Human FOXC1 Protein

Recombinant Human FOXC1 Protein plays a critical role in regulating gene expression by binding to specific DNA sequences and activating or repressing the transcription of target genes. It has been shown to interact with various transcriptional co-regulators, such as histone deacetylases and histone acetyltransferases, to modulate the chromatin structure and regulate gene expression.

One of the key functions of FOXC1 is its involvement in embryonic development. It is expressed in various tissues during embryogenesis and is essential for the development of the eye, brain, heart, and other organs. Studies have shown that mutations in the FOXC1 gene can lead to developmental disorders, including glaucoma, congenital heart defects, and brain malformations.

In addition to its role in embryonic development, Recombinant Human FOXC1 Protein has also been implicated in various diseases and disorders. It has been found to be overexpressed in several types of cancer, including breast, lung, and colon cancer, and has been associated with tumor growth and metastasis. FOXC1 has also been linked to various ocular diseases, such as cataracts and glaucoma, as well as cardiovascular diseases, including atherosclerosis and hypertension.

Application of Recombinant Human FOXC1 Protein

Recombinant Human FOXC1 Protein has a wide range of applications in both basic research and clinical settings. Its ability to regulate gene expression makes it a valuable tool for studying the molecular mechanisms underlying various diseases and disorders. Researchers can use recombinant FOXC1 protein to study its role in embryonic development, cancer, and other diseases, and to identify potential therapeutic targets.

In addition, Recombinant Human FOXC1 Protein can also be used in drug discovery and development. By understanding how FOXC1 regulates gene expression, researchers can develop drugs that target this protein to treat diseases such as cancer and ocular disorders. Furthermore, recombinant FOXC1 protein can also be used in diagnostic tests for diseases associated with FOXC1 overexpression, such as certain types of cancer.

In conclusion, Recombinant Human FOXC1 Protein is a crucial protein that plays a significant role in regulating gene expression and is involved in various cellular processes. Its structure, activity, and applications make it a valuable tool for both basic research and clinical applications, and further studies on this protein may lead to new insights and treatments for various diseases and disorders.

Recombinant Human FOXC1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human FOXC1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products