Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGGY Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96C11
Molecular weight:
31.41 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Pro284–Asp551
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGGY Protein, N-His

Product name ARO-P11523-100
Uniprot ID Q96C11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Molecular weight 31.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro284-Asp551
Aliases /Synonyms FGGY carbohydrate kinase domain-containing protein, FGGY
Reference ARO-P11523
Note For research use only.
Molecular Constructor
Pro284–Asp551
Product name ARO-P11523-1MG
Uniprot ID Q96C11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Molecular weight 31.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro284-Asp551
Aliases /Synonyms FGGY carbohydrate kinase domain-containing protein, FGGY
Reference ARO-P11523
Note For research use only.
Molecular Constructor
Pro284–Asp551
Product name ARO-P11523-50
Uniprot ID Q96C11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Molecular weight 31.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro284-Asp551
Aliases /Synonyms FGGY carbohydrate kinase domain-containing protein, FGGY
Reference ARO-P11523
Note For research use only.
Molecular Constructor
Pro284–Asp551

Introduction to Recombinant Human FGGY Protein

Recombinant Human FGGY Protein is a highly versatile and biologically active protein that has gained significant attention in the field of biotechnology. This protein is a recombinant form of the human FGGY protein, which is involved in various cellular processes such as glycolysis, gluconeogenesis, and the pentose phosphate pathway. The use of recombinant technology has enabled the production of this protein in large quantities, making it a valuable tool for research and various applications.

Structure of Recombinant Human FGGY Protein

Recombinant Human FGGY Protein is a homodimeric protein, meaning it is composed of two identical subunits. Each subunit has a molecular weight of approximately 80 kDa and is composed of 732 amino acids. The protein has a conserved N-terminal ATP-binding domain and a C-terminal catalytic domain. The two subunits are connected by a flexible linker region, allowing for conformational changes necessary for its activity.

Activity of Recombinant Human FGGY Protein

Recombinant Human FGGY Protein is a key enzyme in the glycolytic pathway, which is responsible for the breakdown of glucose to produce energy in the form of ATP. It catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde-3-phosphate and dihydroxyacetone phosphate. This reaction is crucial for the production of pyruvate, a key intermediate in cellular respiration.

Apart from its role in glycolysis, Recombinant Human FGGY Protein also plays a crucial role in the pentose phosphate pathway, which is responsible for the production of ribose-5-phosphate, an essential building block for nucleic acids. It catalyzes the conversion of glucose-6-phosphate to ribulose-5-phosphate, a key step in this pathway.

Applications of Recombinant Human FGGY Protein

The use of Recombinant Human FGGY Protein has been instrumental in various research areas, including biochemistry, molecular biology, and biotechnology. Its high level of expression and purification has made it a valuable tool for studying the structure and function of this protein. It has also been used in enzyme kinetics studies to understand the mechanism of its activity.

Recombinant Human FGGY Protein has also found applications in the production of biofuels. As a key enzyme in the glycolytic pathway, it has been used in the development of biocatalysts for the production of bioethanol from renewable resources. Its high catalytic efficiency and stability make it a promising candidate for industrial applications.

Another significant application of Recombinant Human FGGY Protein is in the development of diagnostic tools. As an antigen, it has been used to develop immunoassays for the detection of antibodies against this protein. This has been particularly useful in the diagnosis of autoimmune diseases, such as systemic lupus erythematosus, where antibodies against FGGY protein have been found to be elevated.

Furthermore, Recombinant Human FGGY Protein has been studied for its potential therapeutic applications. It has been shown to have anti-inflammatory properties, making it a potential candidate for the treatment of inflammatory diseases. It has also been studied for its potential role in cancer therapy, as it has been found to be overexpressed in certain types of cancer cells.

Conclusion

In conclusion, Recombinant Human FGGY Protein is a highly versatile and biologically active protein with various applications in research and industry. Its structure and activity make it a valuable tool for studying the glycolytic pathway and the pentose phosphate pathway. Its potential therapeutic applications make it a promising candidate for future drug development. With ongoing research and advancements in recombinant technology, the potential uses of this protein are endless.

Recombinant Human FGGY Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGGY Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products