Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGFRL1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N441
Molecular weight:
25.55 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Val168–Pro378
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGFRL1, N-His

Product name ARO-P13252-100
Uniprot ID Q8N441
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATSLPWP
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val168-Pro378
Aliases /Synonyms FGF homologous factor receptor, FGFR-like protein, Fibroblast growth factor receptor 5, Fibroblast growth factor receptor-like 1, FGF receptor-like protein 1, FGFRL1, FGFR-5, FHFR, FGFR5
Reference ARO-P13252
Note For research use only.
Molecular Constructor
Val168–Pro378
Product name ARO-P13252-1MG
Uniprot ID Q8N441
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATSLPWP
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val168-Pro378
Aliases /Synonyms FGF homologous factor receptor, FGFR-like protein, Fibroblast growth factor receptor 5, Fibroblast growth factor receptor-like 1, FGF receptor-like protein 1, FGFRL1, FGFR-5, FHFR, FGFR5
Reference ARO-P13252
Note For research use only.
Molecular Constructor
Val168–Pro378
Product name ARO-P13252-50
Uniprot ID Q8N441
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATSLPWP
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val168-Pro378
Aliases /Synonyms FGF homologous factor receptor, FGFR-like protein, Fibroblast growth factor receptor 5, Fibroblast growth factor receptor-like 1, FGF receptor-like protein 1, FGFRL1, FGFR-5, FHFR, FGFR5
Reference ARO-P13252
Note For research use only.
Molecular Constructor
Val168–Pro378

Introduction to Recombinant Human FGFRL1

Recombinant Human FGFRL1, also known as Fibroblast Growth Factor Receptor-like 1, is a protein that plays an important role in cell growth, development, and tissue repair. It belongs to the fibroblast growth factor (FGF) receptor family and is a member of the immunoglobulin superfamily. FGFRL1 is expressed in a variety of tissues, including the heart, brain, lung, and skeletal muscle.

Structure of Recombinant Human FGFRL1

Recombinant Human FGFRL1 is a 343-amino acid protein with a molecular weight of approximately 38 kDa. It consists of an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains three immunoglobulin-like domains, which are responsible for binding to FGF ligands. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain contains the tyrosine kinase activity necessary for signal transduction.

Recombinant Human FGFRL1 is produced through recombinant DNA technology, where the gene encoding FGFRL1 is inserted into a host cell, such as E. coli or Chinese hamster ovary (CHO) cells, to produce large quantities of the protein. This allows for the production of highly pure and biologically active FGFRL1 for use in various research and therapeutic applications.

Activity of Recombinant Human FGFRL1

The primary function of FGFRL1 is to act as a receptor for FGF ligands. FGFs are a family of growth factors that play critical roles in cell proliferation, differentiation, and survival. FGFRL1 specifically binds to FGF1, FGF2, and FGF9, and has been shown to enhance their signaling activity. This suggests that FGFRL1 may act as a co-receptor for these FGFs, increasing their potency and specificity.

In addition to its role in FGF signaling, FGFRL1 has also been implicated in other cellular processes. It has been shown to regulate cell migration, adhesion, and differentiation, as well as play a role in tissue repair and wound healing. FGFRL1 has also been linked to cancer progression, with studies showing its involvement in tumor growth and metastasis.

Application of Recombinant Human FGFRL1

Recombinant Human FGFRL1 has a wide range of applications in both research and therapeutics. In research, it is commonly used as a tool to study FGF signaling and its role in various cellular processes. FGFRL1 is also being investigated as a potential therapeutic target for diseases such as cancer and cardiovascular disorders.

One of the most promising applications of Recombinant Human FGFRL1 is in tissue engineering and regenerative medicine. FGFRL1 has been shown to promote tissue repair and regeneration, making it a potential candidate for the development of novel treatments for tissue injuries and diseases. It has also been shown to enhance the differentiation of stem cells into various cell types, making it a valuable tool in stem cell research and therapy.

Furthermore, Recombinant Human FGFRL1 has potential applications in the development of diagnostic assays for various diseases. Its role in cancer progression and metastasis makes it a potential biomarker for cancer diagnosis and prognosis.

Conclusion

In summary, Recombinant Human FGFRL1 is a biologically active protein with a crucial role in FGF signaling and various cellular processes. Its structure and activity make it a valuable tool for research and a potential therapeutic target for various diseases. With ongoing research and development, Recombinant Human FGFRL1 holds great promise for future advancements in medicine and biotechnology.

Recombinant Human FGFRL1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGFRL1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products