Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FABP7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O15540
Molecular weight:
17.05 kDa

Original price was: €281.00.Current price is: €230.00.

50ug 18% OFF + 230 loyalty points
Met1–Ala132
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FABP7 Protein, N-His

Product name ARO-P11703-100
Uniprot ID O15540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Molecular weight 17.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala132
Aliases /Synonyms FABPB, Fatty acid-binding protein 7, Brain lipid-binding protein, BLBP, B-FABP, MRG, Mammary-derived growth inhibitor related, FABP7, Brain-type fatty acid-binding protein, Fatty acid-binding protein, brain
Reference ARO-P11703
Note For research use only.
Molecular Constructor
Met1–Ala132
Product name ARO-P11703-1MG
Uniprot ID O15540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Molecular weight 17.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala132
Aliases /Synonyms FABPB, Fatty acid-binding protein 7, Brain lipid-binding protein, BLBP, B-FABP, MRG, Mammary-derived growth inhibitor related, FABP7, Brain-type fatty acid-binding protein, Fatty acid-binding protein, brain
Reference ARO-P11703
Note For research use only.
Molecular Constructor
Met1–Ala132
Product name ARO-P11703-50
Uniprot ID O15540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Molecular weight 17.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala132
Aliases /Synonyms FABPB, Fatty acid-binding protein 7, Brain lipid-binding protein, BLBP, B-FABP, MRG, Mammary-derived growth inhibitor related, FABP7, Brain-type fatty acid-binding protein, Fatty acid-binding protein, brain
Reference ARO-P11703
Note For research use only.
Molecular Constructor
Met1–Ala132

Introduction

Recombinant Human FABP7 Protein, also known as Fatty Acid Binding Protein 7, is a highly conserved protein that plays a crucial role in lipid metabolism and transport. This protein is encoded by the FABP7 gene and is expressed in various tissues such as the brain, heart, and liver. In this article, we will discuss the structure, activity, and application of Recombinant Human FABP7 Protein.

Structure of Recombinant Human FABP7 Protein

The Recombinant Human FABP7 Protein is a small, 15 kilodalton (kDa) protein consisting of 132 amino acids. It belongs to the fatty acid binding protein (FABP) family, which includes nine other members. The protein has a highly conserved tertiary structure, with a beta-barrel core and two alpha-helices. The beta-barrel core contains a binding pocket that can accommodate long-chain fatty acids, while the alpha-helices help in protein stability and ligand binding.

The crystal structure of Recombinant Human FABP7 Protein has been determined, revealing the presence of two calcium ions in the binding pocket. These calcium ions are essential for the structural integrity and ligand binding of the protein. The binding pocket also contains two tryptophan residues, which are involved in the binding of fatty acids.

Activity of Recombinant Human FABP7 Protein

Recombinant Human FABP7 Protein is primarily involved in the transport of fatty acids from the cytoplasm to the nucleus. It binds to long-chain fatty acids, such as arachidonic acid and docosahexaenoic acid, with high affinity and transports them to specific target sites. The binding of fatty acids induces a conformational change in the protein, which facilitates the release of the ligand in the nucleus.

Besides its role in fatty acid transport, Recombinant Human FABP7 Protein also plays a crucial role in lipid metabolism. It has been shown to regulate the expression of genes involved in lipid synthesis and metabolism, such as PPAR-alpha and SREBP-1c. This protein also has anti-inflammatory properties and has been found to inhibit the production of pro-inflammatory cytokines in immune cells.

Application of Recombinant Human FABP7 Protein

The unique structure and activity of Recombinant Human FABP7 Protein make it a valuable tool in various scientific applications. One of the main applications of this protein is in lipid metabolism research. It can be used to study the transport and metabolism of fatty acids in various tissues and cell types. Recombinant Human FABP7 Protein can also be used to investigate the role of this protein in lipid-related diseases, such as obesity and diabetes.

Another potential application of Recombinant Human FABP7 Protein is in drug discovery. As this protein is involved in the regulation of lipid metabolism, it can be targeted for the development of new drugs for the treatment of metabolic disorders. Recombinant Human FABP7 Protein can also be used as a biomarker for various diseases. Its expression has been linked to various cancers, and it has been proposed as a potential diagnostic and prognostic marker for these diseases.

Furthermore, Recombinant Human FABP7 Protein can be used in the development of diagnostic and therapeutic agents. The fatty acid binding pocket of this protein can be targeted for the delivery of drugs or imaging agents to specific tissues. This targeted approach can improve the efficacy and reduce the side effects of these agents.

Conclusion

Recombinant Human FABP7 Protein is a highly conserved protein with a crucial role in lipid metabolism and transport. Its unique structure and activity make it a valuable tool in various scientific applications, including lipid metabolism research, drug discovery, and disease diagnosis and treatment. With ongoing research, the potential applications of

Recombinant Human FABP7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FABP7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products