Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EFNA3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52797
Molecular weight:
28.01 kDa

Original price was: €265.00.Current price is: €230.00.

50ug 13% OFF + 230 loyalty points
Gly30–Val165
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EFNA3 Protein, N-His-SUMO

Product name ARO-P11322-100
Uniprot ID P52797
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFV
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly30-Val165
Aliases /Synonyms EPLG3, EPH-related receptor tyrosine kinase ligand 3, EFL2, LERK-3, EFNA3, Ephrin-A3, LERK3, EFL-2, EHK1-L, EHK1 ligand
Reference ARO-P11322
Note For research use only.
Molecular Constructor
Gly30–Val165
Product name ARO-P11322-1MG
Uniprot ID P52797
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFV
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly30-Val165
Aliases /Synonyms EPLG3, EPH-related receptor tyrosine kinase ligand 3, EFL2, LERK-3, EFNA3, Ephrin-A3, LERK3, EFL-2, EHK1-L, EHK1 ligand
Reference ARO-P11322
Note For research use only.
Molecular Constructor
Gly30–Val165
Product name ARO-P11322-50
Uniprot ID P52797
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFV
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly30-Val165
Aliases /Synonyms EPLG3, EPH-related receptor tyrosine kinase ligand 3, EFL2, LERK-3, EFNA3, Ephrin-A3, LERK3, EFL-2, EHK1-L, EHK1 ligand
Reference ARO-P11322
Note For research use only.
Molecular Constructor
Gly30–Val165

Introduction

Recombinant Human EFNA3 Protein, also known as ephrin-A3, is a member of the ephrin family of proteins. It is a glycosylphosphatidylinositol (GPI)-anchored protein that plays a crucial role in cell signaling and tissue development. In this article, we will discuss the structure, activity, and application of Recombinant Human EFNA3 Protein.

Structure of Recombinant Human EFNA3 Protein

Recombinant Human EFNA3 Protein is a 33 kDa protein consisting of 231 amino acids. It contains a conserved N-terminal ephrin domain, a transmembrane region, and a C-terminal GPI anchor. The ephrin domain is responsible for binding to its receptor, EphA receptors, and initiating downstream signaling pathways.

Activity of Recombinant Human EFNA3 Protein

Recombinant Human EFNA3 Protein is a potent ligand for EphA receptors, specifically EphA4 and EphA5. Binding of EFNA3 to these receptors leads to the activation of multiple signaling pathways, including the mitogen-activated protein kinase (MAPK) pathway and the phosphoinositide 3-kinase (PI3K) pathway. These pathways are involved in cell proliferation, survival, and differentiation.

In addition to its role in cell signaling, EFNA3 also plays a crucial role in tissue development. It is involved in axon guidance, neuronal migration, and synapse formation. EFNA3 is also known to regulate cell adhesion and motility, which are important processes in tissue development and wound healing.

Application of Recombinant Human EFNA3 Protein

Due to its role in cell signaling and tissue development, Recombinant Human EFNA3 Protein has various applications in the field of research and medicine. Some of these applications include:

1. Recombinant Protein Production

Recombinant Human EFNA3 Protein is widely used as a recombinant protein in various research studies. It can be produced in large quantities using recombinant DNA technology, making it easily accessible for research purposes.

2. Antigen for Antibody Production

EFNA3 has been identified as a potential antigen for antibody production. Antibodies against EFNA3 can be used to study its expression and function in different tissues and cell types. These antibodies can also be used in diagnostic tests for diseases associated with EFNA3 dysregulation.

3. Potential Therapeutic Target

The dysregulation of EFNA3 has been linked to various diseases, including cancer, Alzheimer’s disease, and multiple sclerosis. Therefore, EFNA3 is being explored as a potential therapeutic target for these diseases. Recombinant Human EFNA3 Protein can be used in preclinical studies to evaluate its efficacy as a therapeutic target.

4. Tissue Engineering

EFNA3’s role in tissue development and wound healing makes it a potential candidate for tissue engineering applications. Recombinant Human EFNA3 Protein can be used to promote cell adhesion and migration, leading to the formation of functional tissues.

5. Drug Screening

The dysregulation of EFNA3 has been implicated in drug resistance in cancer cells. Recombinant Human EFNA3 Protein can be used in drug screening assays to identify potential compounds that can target EFNA3 and overcome drug resistance.

Conclusion

In summary, Recombinant Human EFNA3 Protein is a crucial protein involved in cell signaling and tissue development. Its structure, activity, and various applications make it a valuable tool in research and medicine. Further studies on EFNA3 and its interactions with other proteins and receptors may lead to the development of new therapies for diseases associated with its dysregulation.

Recombinant Human EFNA3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human EFNA3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products