Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EDNRB/ETRB Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P24530
Molecular weight:
32.42 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Glu236–Thr271
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EDNRB/ETRB Protein, N-GST & C-His

Product name ARO-P11349-100
Uniprot ID P24530
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKT
Molecular weight 32.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu236-Thr271
Aliases /Synonyms Endothelin receptor type B, EDNRB, ETRB, ET-BR, Endothelin receptor non-selective type, ET-B
Reference ARO-P11349
Note For research use only.
Molecular Constructor
Glu236–Thr271
Product name ARO-P11349-1MG
Uniprot ID P24530
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKT
Molecular weight 32.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu236-Thr271
Aliases /Synonyms Endothelin receptor type B, EDNRB, ETRB, ET-BR, Endothelin receptor non-selective type, ET-B
Reference ARO-P11349
Note For research use only.
Molecular Constructor
Glu236–Thr271
Product name ARO-P11349-50
Uniprot ID P24530
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKT
Molecular weight 32.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu236-Thr271
Aliases /Synonyms Endothelin receptor type B, EDNRB, ETRB, ET-BR, Endothelin receptor non-selective type, ET-B
Reference ARO-P11349
Note For research use only.
Molecular Constructor
Glu236–Thr271

Introduction to Recombinant Human EDNRB/ETRB Protein

Recombinant Human EDNRB/ETRB Protein, also known as Endothelin receptor type B (ETRB), is a protein that is encoded by the EDNRB gene. It belongs to the G protein-coupled receptor family and is expressed in a variety of tissues, including smooth muscle cells, endothelial cells, and neurons. This protein plays a crucial role in regulating vasoconstriction, cell proliferation, and migration, making it an important target for therapeutic interventions.

Structure of Recombinant Human EDNRB/ETRB Protein

Recombinant Human EDNRB/ETRB Protein is a transmembrane protein, consisting of 442 amino acids with a molecular weight of approximately 50 kDa. It is composed of an extracellular N-terminal domain, seven transmembrane helices, and an intracellular C-terminal domain. The N-terminal domain contains the binding site for the endogenous ligand, endothelin, while the transmembrane helices are responsible for signal transduction. The C-terminal domain is involved in G protein coupling and downstream signaling.

Activity of Recombinant Human EDNRB/ETRB Protein

The main function of Recombinant Human EDNRB/ETRB Protein is to bind to endothelin and activate downstream signaling pathways. Endothelin is a vasoconstrictor peptide that is produced by endothelial cells and plays a crucial role in regulating blood pressure and vascular tone. When endothelin binds to EDNRB, it triggers a cascade of events that leads to vasoconstriction, cell proliferation, and migration. This activity is mediated by G proteins, which are activated upon binding of endothelin to EDNRB.

In addition to its role in vasoconstriction, Recombinant Human EDNRB/ETRB Protein also plays a crucial role in neural crest cell development and migration. Neural crest cells are a group of cells that give rise to various tissues and structures in the body, including the peripheral nervous system, melanocytes, and smooth muscle cells. EDNRB is expressed on the surface of neural crest cells and is required for their migration and differentiation. Mutations in the EDNRB gene have been linked to Hirschsprung’s disease, a disorder characterized by the absence of enteric ganglia in the colon, which is caused by defective neural crest cell migration.

Application of Recombinant Human EDNRB/ETRB Protein

Recombinant Human EDNRB/ETRB Protein has a wide range of applications in both research and therapeutic settings. In research, it is used as an antigen to study the structure and function of the protein. Recombinant EDNRB can be produced in large quantities using recombinant DNA technology, making it a valuable tool for biochemical and biophysical studies.

In therapeutic settings, Recombinant Human EDNRB/ETRB Protein is being investigated as a potential target for the treatment of various cardiovascular diseases, such as hypertension, atherosclerosis, and heart failure. By blocking the activity of EDNRB, it is possible to reduce vasoconstriction and lower blood pressure. In addition, EDNRB antagonists have shown promising results in inhibiting cancer cell proliferation and migration, making them potential candidates for cancer therapy.

Furthermore, Recombinant Human EDNRB/ETRB Protein is also being studied for its potential role in the treatment of Hirschsprung’s disease. By restoring the function of EDNRB, it may be possible to correct the defect in neural crest cell migration and alleviate the symptoms of this disorder.

Conclusion

In summary, Recombinant Human EDNRB/ETRB Protein is a crucial protein involved in regulating vasoconstriction, cell proliferation, and migration. Its structure, activity, and application make it a valuable target for both research and therapeutic purposes. Further studies on this protein may lead to the development of novel treatments for various cardiovascular diseases and disorders related to neural crest cell migration.

Recombinant Human EDNRB/ETRB Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human EDNRB/ETRB Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products