Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DYNLL2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96FJ2
Molecular weight:
22.56 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points
Ser2–Gly89
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DYNLL2 Protein, N-His-SUMO

Product name ARO-P11252-100
Uniprot ID Q96FJ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly89
Aliases /Synonyms Dynein light chain LC8-type 2, DLC2, 8 kDa dynein light chain b, DLC8b, Dynein light chain 2, cytoplasmic, DYNLL2
Reference ARO-P11252
Note For research use only.
Molecular Constructor
Ser2–Gly89
Product name ARO-P11252-1MG
Uniprot ID Q96FJ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly89
Aliases /Synonyms Dynein light chain LC8-type 2, DLC2, 8 kDa dynein light chain b, DLC8b, Dynein light chain 2, cytoplasmic, DYNLL2
Reference ARO-P11252
Note For research use only.
Molecular Constructor
Ser2–Gly89
Product name ARO-P11252-50
Uniprot ID Q96FJ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly89
Aliases /Synonyms Dynein light chain LC8-type 2, DLC2, 8 kDa dynein light chain b, DLC8b, Dynein light chain 2, cytoplasmic, DYNLL2
Reference ARO-P11252
Note For research use only.
Molecular Constructor
Ser2–Gly89

Introduction

Recombinant Human DYNLL2 Protein, also known as Dynein Light Chain LC8-Type 2 or DLC8, is a protein that plays a crucial role in a variety of cellular processes. It is a member of the dynein light chain family and is highly conserved across species, with a 97% sequence identity between human and mouse. The protein is encoded by the DYNLL2 gene and is expressed in almost all tissues, with the highest levels found in the brain, heart, and skeletal muscle.

Structure of Recombinant Human DYNLL2 Protein

Recombinant Human DYNLL2 Protein is a small protein consisting of 89 amino acids with a molecular weight of approximately 10 kDa. It has a globular structure with a beta-sheet core surrounded by alpha-helices. The protein contains a highly conserved LC8 domain, which is essential for its function. DYNLL2 also has a flexible C-terminal tail that is involved in protein-protein interactions.

The recombinant form of DYNLL2 is produced by cloning the DYNLL2 gene into a suitable expression vector and expressing it in a host organism, usually E. coli or yeast. This allows for large-scale production of the protein for research purposes.

Activity of Recombinant Human DYNLL2 Protein

Recombinant Human DYNLL2 Protein is a multifunctional protein that is involved in a wide range of cellular processes. It was initially identified as a subunit of the dynein motor complex, which is responsible for intracellular transport along microtubules. DYNLL2 binds to the light chain of the dynein motor and facilitates its movement, thus playing a crucial role in cellular transport processes.

Aside from its role in intracellular transport, DYNLL2 has also been found to interact with a variety of other proteins, including transcription factors, cytoskeletal proteins, and enzymes. These interactions suggest that DYNLL2 may have a regulatory role in various cellular processes, such as cell division, apoptosis, and metabolism.

Recent studies have also shown that DYNLL2 is involved in the regulation of mitosis and cytokinesis. It has been found to interact with the spindle checkpoint protein Bub3 and play a crucial role in ensuring proper chromosome segregation during cell division. DYNLL2 has also been implicated in the regulation of cytokinesis by interacting with the contractile ring protein Anillin.

Application of Recombinant Human DYNLL2 Protein

Recombinant Human DYNLL2 Protein has a wide range of applications in scientific research, particularly in the fields of cell biology and molecular biology. Its involvement in various cellular processes makes it a valuable tool for studying the function and regulation of these processes.

One of the main applications of DYNLL2 is in the study of intracellular transport. Its interaction with the dynein motor complex makes it a useful tool for investigating the mechanisms of intracellular transport and its role in various diseases, such as neurodegenerative disorders and cancer.

Additionally, DYNLL2 has been found to have potential as a therapeutic target. Its involvement in cell division and cytokinesis makes it a promising target for the development of new cancer treatments. Furthermore, its interaction with various signaling proteins suggests that it may have a role in regulating cellular processes that are dysregulated in diseases such as diabetes and cardiovascular diseases.

Conclusion

Recombinant Human DYNLL2 Protein is a highly conserved and multifunctional protein that plays a crucial role in various cellular processes. Its structure and activity make it a valuable tool for studying intracellular transport and its potential as a therapeutic target. As research on DYNLL2 continues, it is likely that its applications in scientific research and medicine will continue to expand.

Recombinant Human DYNLL2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human DYNLL2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products