Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DNAJC19 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96DA6
Molecular weight:
23.77 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
His-SUMO Ala25–Lys116 Strep
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DNAJC19 Protein, N-His-SUMO & C-Strep

Product name ARO-P16248-100
Uniprot ID Q96DA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Molecular weight 23.77 kDa
Protein delivered with Tag? N-Terminal His-SUMO & C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala25-Lys116
Aliases /Synonyms DNAJC19, DnaJ homolog subfamily C member 19, TIM14, TIMM14, Mitochondrial import inner membrane translocase subunit TIM14
Reference ARO-P16248
Note For research use only.
Molecular Constructor
His-SUMO Ala25–Lys116 Strep
Product name ARO-P16248-1MG
Uniprot ID Q96DA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Molecular weight 23.77 kDa
Protein delivered with Tag? N-Terminal His-SUMO & C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala25-Lys116
Aliases /Synonyms DNAJC19, DnaJ homolog subfamily C member 19, TIM14, TIMM14, Mitochondrial import inner membrane translocase subunit TIM14
Reference ARO-P16248
Note For research use only.
Molecular Constructor
His-SUMO Ala25–Lys116 Strep
Product name ARO-P16248-50
Uniprot ID Q96DA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Molecular weight 23.77 kDa
Protein delivered with Tag? N-Terminal His-SUMO & C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala25-Lys116
Aliases /Synonyms DNAJC19, DnaJ homolog subfamily C member 19, TIM14, TIMM14, Mitochondrial import inner membrane translocase subunit TIM14
Reference ARO-P16248
Note For research use only.
Molecular Constructor
His-SUMO Ala25–Lys116 Strep

There are no reviews yet.

Be the first to review “Recombinant Human DNAJC19 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products