Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13838
Molecular weight:
22.17 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Leu259–Arg428
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His

Product name ARO-P12659-100
Uniprot ID Q13838
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Molecular weight 22.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu259-Arg428
Aliases /Synonyms BAT1, Spliceosome RNA helicase DDX39B, ATP-dependent RNA helicase p47, DEAD box protein UAP56, DDX39B, UAP56, HLA-B-associated transcript 1 protein, 56 kDa U2AF65-associated protein
Reference ARO-P12659
Note For research use only.
Molecular Constructor
Leu259–Arg428
Product name ARO-P12659-1MG
Uniprot ID Q13838
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Molecular weight 22.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu259-Arg428
Aliases /Synonyms BAT1, Spliceosome RNA helicase DDX39B, ATP-dependent RNA helicase p47, DEAD box protein UAP56, DDX39B, UAP56, HLA-B-associated transcript 1 protein, 56 kDa U2AF65-associated protein
Reference ARO-P12659
Note For research use only.
Molecular Constructor
Leu259–Arg428
Product name ARO-P12659-50
Uniprot ID Q13838
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Molecular weight 22.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu259-Arg428
Aliases /Synonyms BAT1, Spliceosome RNA helicase DDX39B, ATP-dependent RNA helicase p47, DEAD box protein UAP56, DDX39B, UAP56, HLA-B-associated transcript 1 protein, 56 kDa U2AF65-associated protein
Reference ARO-P12659
Note For research use only.
Molecular Constructor
Leu259–Arg428

Introduction

Recombinant Human DDX39B/BAT1/UAP56 Protein, also known as DEAD-box helicase 39B, is a highly conserved protein that plays a crucial role in RNA metabolism and processing. It belongs to the DEAD-box family of proteins, which are ATP-dependent RNA helicases that unwind RNA duplexes and facilitate RNA-RNA and RNA-protein interactions. DDX39B is involved in various cellular processes, including pre-mRNA splicing, mRNA export, and translation initiation, making it an essential protein for maintaining proper gene expression.

Structure of Recombinant Human DDX39B/BAT1/UAP56 Protein

The Recombinant Human DDX39B/BAT1/UAP56 Protein is a 56-kDa protein composed of 504 amino acids. It contains a conserved ATPase/helicase domain, a C-terminal RNA-binding domain, and an N-terminal domain that is involved in protein-protein interactions. The ATPase/helicase domain is responsible for the ATP-dependent unwinding of RNA duplexes, while the RNA-binding domain recognizes specific RNA sequences and mediates RNA-protein interactions.

Activity of Recombinant Human DDX39B/BAT1/UAP56 Protein

Recombinant Human DDX39B/BAT1/UAP56 Protein is a multifunctional protein that plays a crucial role in various stages of RNA metabolism. It acts as an RNA helicase, unwinding RNA duplexes to facilitate RNA-RNA and RNA-protein interactions. DDX39B is also involved in pre-mRNA splicing, where it promotes the assembly of the spliceosome and facilitates the removal of introns from pre-mRNA. Moreover, DDX39B is essential for mRNA export from the nucleus to the cytoplasm, as it interacts with other export factors to ensure proper transport of mRNA.

Another important activity of Recombinant Human DDX39B/BAT1/UAP56 Protein is its role in translation initiation. It interacts with eukaryotic initiation factors (eIFs) and promotes the recruitment of the 40S ribosomal subunit to the mRNA, thereby facilitating translation initiation. DDX39B also plays a role in regulating the translation of specific mRNAs, making it a critical protein for controlling gene expression.

Application of Recombinant Human DDX39B/BAT1/UAP56 Protein

Recombinant Human DDX39B/BAT1/UAP56 Protein has various applications in both basic research and biotechnology. Its role in RNA metabolism and processing makes it a valuable tool for studying gene expression and regulation. DDX39B is also implicated in various diseases, including cancer, making it an attractive target for drug development.

One of the main applications of Recombinant Human DDX39B/BAT1/UAP56 Protein is in studying pre-mRNA splicing. Its role in promoting spliceosome assembly and regulating splicing makes it an essential protein for understanding the splicing process. Researchers can use recombinant DDX39B protein to study the effects of DDX39B mutations on splicing and to investigate its role in diseases caused by splicing defects.

Moreover, Recombinant Human DDX39B/BAT1/UAP56 Protein is a valuable tool for studying mRNA export and translation initiation. Its interactions with other export factors and eIFs can be studied using recombinant DDX39B protein, providing insights into the mechanisms of these processes. Additionally, DDX39B is involved in regulating the translation of specific mRNAs, making it a potential target for developing therapeutic interventions for diseases caused by dysregulated translation.

In the biotechnology industry, Recombinant Human DDX39B/BAT1/UAP56 Protein can be used for the production of recombinant proteins. Its RNA helicase activity can be utilized to unwind RNA duplexes and facilitate the translation of recombinant mRNAs, thereby increasing the yield of recombinant proteins.

Conclusion

In summary,

Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products