Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CREB3L2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q70SY1
Molecular weight:
17.58 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Ala245–Leu380
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CREB3L2 Protein, N-His

Product name ARO-P11261-100
Uniprot ID Q70SY1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCL
Molecular weight 17.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala245-Leu380
Aliases /Synonyms CREB3L2, Cyclic AMP-responsive element-binding protein 3-like protein 2, cAMP-responsive element-binding protein 3-like protein 2, BBF2H7, BBF2 human homolog on chromosome 7
Reference ARO-P11261
Note For research use only.
Molecular Constructor
Ala245–Leu380
Product name ARO-P11261-1MG
Uniprot ID Q70SY1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCL
Molecular weight 17.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala245-Leu380
Aliases /Synonyms CREB3L2, Cyclic AMP-responsive element-binding protein 3-like protein 2, cAMP-responsive element-binding protein 3-like protein 2, BBF2H7, BBF2 human homolog on chromosome 7
Reference ARO-P11261
Note For research use only.
Molecular Constructor
Ala245–Leu380
Product name ARO-P11261-50
Uniprot ID Q70SY1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCL
Molecular weight 17.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala245-Leu380
Aliases /Synonyms CREB3L2, Cyclic AMP-responsive element-binding protein 3-like protein 2, cAMP-responsive element-binding protein 3-like protein 2, BBF2H7, BBF2 human homolog on chromosome 7
Reference ARO-P11261
Note For research use only.
Molecular Constructor
Ala245–Leu380

Introduction

The Recombinant Human CREB3L2 Protein is a highly versatile protein that plays a crucial role in various biological processes. It is a member of the cAMP response element binding (CREB) family of transcription factors and is encoded by the CREB3L2 gene. This protein has been extensively studied and has been found to have important functions in both normal and pathological conditions. In this article, we will discuss the structure, activity, and applications of Recombinant Human CREB3L2 Protein.

Structure of Recombinant Human CREB3L2 Protein

The human CREB3L2 gene is located on chromosome 7 and consists of 12 exons. The protein is composed of 509 amino acids with a molecular weight of approximately 58 kDa. It contains a basic leucine zipper (bZIP) domain, which is responsible for DNA binding and dimerization, and a transmembrane domain, which anchors the protein to the endoplasmic reticulum (ER) membrane. The bZIP domain is also involved in the interaction with other proteins and regulates the transcriptional activity of CREB3L2.

Activity of Recombinant Human CREB3L2 Protein

The main activity of Recombinant Human CREB3L2 Protein is its role as a transcription factor. It is activated in response to various stress signals, such as ER stress, hypoxia, and viral infection. Upon activation, CREB3L2 translocates from the ER to the Golgi apparatus, where it is cleaved by proteases, releasing the active form of the protein. The active form then translocates to the nucleus, where it binds to specific DNA sequences and regulates the expression of target genes.

Studies have shown that CREB3L2 is involved in the regulation of various biological processes, including cell proliferation, differentiation, and survival. It has also been implicated in the development and progression of several diseases, such as cancer, neurodegenerative disorders, and metabolic disorders. For example, CREB3L2 has been found to promote the growth and survival of cancer cells by regulating the expression of genes involved in cell cycle progression and apoptosis. On the other hand, it has been shown to have a protective role in neurodegenerative diseases by promoting the clearance of misfolded proteins in the ER.

Applications of Recombinant Human CREB3L2 Protein

Due to its diverse functions and involvement in various diseases, Recombinant Human CREB3L2 Protein has a wide range of applications in both basic and clinical research. One of the main applications is in the study of the ER stress response and its role in disease development. Researchers can use recombinant CREB3L2 protein to investigate the mechanisms of ER stress and its effects on cell function and survival. This can provide valuable insights into the pathogenesis of diseases and potential therapeutic targets.

Another important application of Recombinant Human CREB3L2 Protein is in drug discovery and development. As mentioned earlier, CREB3L2 is involved in the regulation of various biological processes, making it a potential target for drug intervention. By studying the activity and function of recombinant CREB3L2 protein, researchers can identify compounds that can modulate its activity and potentially develop new treatments for diseases.

Furthermore, recombinant CREB3L2 protein can also be used in diagnostic assays. As CREB3L2 is involved in the development and progression of certain diseases, its levels and activity can serve as biomarkers for disease diagnosis and prognosis. By using recombinant CREB3L2 protein in diagnostic tests, researchers can accurately detect and monitor disease progression.

Conclusion

In conclusion, Recombinant Human CREB3L2 Protein is a crucial protein with diverse functions in various biological processes. Its structure, activity, and applications have been extensively studied and continue to

Recombinant Human CREB3L2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CREB3L2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products