Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human COQ9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75208
Molecular weight:
27.56 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Ser95–Arg318
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human COQ9 Protein, N-His

Product name ARO-P11220-100
Uniprot ID O75208
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Molecular weight 27.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser95-Arg318
Aliases /Synonyms Ubiquinone biosynthesis protein COQ9, mitochondrial, C16orf49, COQ9
Reference ARO-P11220
Note For research use only.
Molecular Constructor
Ser95–Arg318
Product name ARO-P11220-1MG
Uniprot ID O75208
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Molecular weight 27.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser95-Arg318
Aliases /Synonyms Ubiquinone biosynthesis protein COQ9, mitochondrial, C16orf49, COQ9
Reference ARO-P11220
Note For research use only.
Molecular Constructor
Ser95–Arg318
Product name ARO-P11220-50
Uniprot ID O75208
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Molecular weight 27.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser95-Arg318
Aliases /Synonyms Ubiquinone biosynthesis protein COQ9, mitochondrial, C16orf49, COQ9
Reference ARO-P11220
Note For research use only.
Molecular Constructor
Ser95–Arg318

Introduction to Recombinant Human COQ9 Protein

Recombinant Human COQ9 Protein is a key enzyme involved in the biosynthesis of coenzyme Q10 (CoQ10), a vital component of the electron transport chain and an important antioxidant in human cells. This protein is produced through recombinant DNA technology, making it a highly pure and efficient source of COQ9 for research and therapeutic applications.

Structure of Recombinant Human COQ9 Protein

The COQ9 gene encodes a 282 amino acid protein with a predicted molecular weight of 32 kDa. The recombinant protein is expressed in E. coli and purified using chromatography techniques. It has a similar structure to the native human COQ9 protein, with a conserved N-terminal domain and a C-terminal domain that contains the active site for CoQ10 biosynthesis.

The recombinant protein is highly stable and retains its enzymatic activity even after multiple freeze-thaw cycles, making it an ideal source for biochemical studies.

Enzymatic Activity of Recombinant Human COQ9 Protein

Recombinant Human COQ9 Protein is a multi-functional enzyme that plays a crucial role in the biosynthesis of CoQ10. It acts as a scaffolding protein, facilitating the interaction between other enzymes involved in the CoQ10 biosynthetic pathway.

The main function of COQ9 is to catalyze the hydroxylation of 4-hydroxybenzoate (4-HB) to 3-hexaprenyl-4-hydroxybenzoate (3-HB) in the presence of oxygen and NADH. This reaction is essential for the synthesis of CoQ10, which is then incorporated into the electron transport chain to generate ATP.

Moreover, COQ9 also plays a regulatory role in maintaining the proper balance of CoQ10 in the cell. It acts as a chaperone for other enzymes involved in CoQ10 biosynthesis, ensuring their correct folding and function.

Applications of Recombinant Human COQ9 Protein

The availability of highly pure and active Recombinant Human COQ9 Protein has enabled significant advancements in the understanding of CoQ10 biosynthesis and its role in human health. Here are some of the key applications of this recombinant protein:

1. Biochemical Studies

Recombinant Human COQ9 Protein is widely used in in vitro biochemical studies to investigate the mechanism of CoQ10 biosynthesis. Its high purity and stability allow for accurate determination of its enzymatic activity, as well as its interactions with other enzymes in the pathway.

2. Drug Development

COQ9 deficiency has been linked to various diseases, including mitochondrial disorders and neurodegenerative diseases. Recombinant Human COQ9 Protein has been used in drug development studies to identify potential therapeutic agents for these conditions. It can also be used as a target for drug screening and lead optimization.

3. Diagnostic Assays

COQ9 is a potential biomarker for CoQ10 deficiency and related diseases. Recombinant Human COQ9 Protein can be used to develop sensitive and specific diagnostic assays for the detection of COQ9 levels in patient samples.

4. Immunogen for Antibody Production

Recombinant Human COQ9 Protein can be used as an antigen to generate highly specific antibodies for research and diagnostic purposes. These antibodies can be used to study the expression and localization of COQ9 in different tissues and cell types.

5. Therapeutic Protein

Given its crucial role in CoQ10 biosynthesis, Recombinant Human COQ9 Protein has potential therapeutic applications. It can be used as a supplement for individuals with CoQ10 deficiency or as a therapeutic agent for

Recombinant Human COQ9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human COQ9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products