Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CFL2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y281
Molecular weight:
30.95 kDa

Original price was: €303.00.Current price is: €275.00.

100ug 9% OFF + 275 loyalty points
Ala2–Leu166
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CFL2 Protein, N-His-SUMO

Product name ARO-P11137-100
Uniprot ID Q9Y281
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Molecular weight 30.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Leu166
Aliases /Synonyms CFL2, Cofilin-2, Cofilin, muscle isoform
Reference ARO-P11137
Note For research use only.
Molecular Constructor
Ala2–Leu166
Product name ARO-P11137-1MG
Uniprot ID Q9Y281
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Molecular weight 30.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Leu166
Aliases /Synonyms CFL2, Cofilin-2, Cofilin, muscle isoform
Reference ARO-P11137
Note For research use only.
Molecular Constructor
Ala2–Leu166
Product name ARO-P11137-50
Uniprot ID Q9Y281
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Molecular weight 30.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Leu166
Aliases /Synonyms CFL2, Cofilin-2, Cofilin, muscle isoform
Reference ARO-P11137
Note For research use only.
Molecular Constructor
Ala2–Leu166

Introduction to Recombinant Human CFL2 Protein

Recombinant Human CFL2 Protein, also known as Cofilin-2, is a protein that plays a crucial role in the regulation of actin dynamics in cells. It is a member of the cofilin family of proteins, which are essential for the proper functioning of the cytoskeleton and cell movement. In this article, we will explore the structure, activity, and applications of this important protein.

Structure of Recombinant Human CFL2 Protein

The human CFL2 gene is located on chromosome 14 and encodes for a protein of 166 amino acids. The protein has a molecular weight of approximately 19 kDa and is composed of two domains: an N-terminal domain and a C-terminal domain. The N-terminal domain contains a highly conserved actin-binding site, while the C-terminal domain is involved in regulating the activity of the protein.

The structure of Recombinant Human CFL2 Protein is similar to that of other members of the cofilin family, with a central alpha-helical region flanked by two beta-sheets. This unique structure allows the protein to interact with actin filaments and promote their disassembly, leading to changes in cell shape and movement.

Activity of Recombinant Human CFL2 Protein

Recombinant Human CFL2 Protein is a key regulator of actin dynamics in cells. It binds to actin filaments and promotes their disassembly, leading to changes in cell shape and movement. This process is essential for various cellular processes, including cell migration, cell division, and tissue development.

Moreover, Recombinant Human CFL2 Protein has been shown to play a role in the formation of dendritic spines, which are small protrusions on the surface of neurons that play a crucial role in synaptic plasticity and learning. The protein is also involved in the regulation of cell adhesion and cell signaling pathways, making it a versatile player in cellular processes.

Applications of Recombinant Human CFL2 Protein

Due to its crucial role in regulating actin dynamics, Recombinant Human CFL2 Protein has a wide range of applications in both research and therapeutic settings. In research, the protein is used as an antigen in studies investigating the role of cofilin in various cellular processes. It is also used in experiments to study the effects of cofilin mutations on protein function.

In therapeutic settings, Recombinant Human CFL2 Protein has shown potential in the treatment of diseases that involve abnormal actin dynamics. For example, it has been studied as a potential treatment for cancer, as it can inhibit cell migration and invasion, which are essential processes for tumor growth and metastasis. The protein has also been investigated for its potential in treating neurological disorders, such as Alzheimer’s disease, where it may play a role in regulating dendritic spine formation and synaptic plasticity.

Conclusion

Recombinant Human CFL2 Protein is a vital player in the regulation of actin dynamics in cells. Its unique structure and activity make it a versatile protein with various roles in cellular processes. Its applications in research and therapy make it a valuable tool for understanding and treating diseases that involve abnormal actin dynamics. Further studies on this protein may reveal new insights into its function and potential therapeutic applications.

Keywords: Recombinant Human CFL2 Protein, antigen, actin dynamics, cell migration, cell division, dendritic spines, cell adhesion, cell signaling, cancer, Alzheimer’s disease, therapeutic applications.

Recombinant Human CFL2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CFL2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products