Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CELF2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95319
Molecular weight:
21.56 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Lys41–Asp211
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CELF2 Protein, N-His

Product name ARO-P12070-100
Uniprot ID O95319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFAD
Molecular weight 21.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys41-Asp211
Aliases /Synonyms CELF-2, hNAPOR, Neuroblastoma apoptosis-related RNA-binding protein, CUGBP Elav-like family member 2, CUG-BP- and ETR-3-like factor 2, BRUNOL3, NAPOR, ETR3, CUGBP2, CUG triplet repeat RNA-binding protein 2, ETR-3, CELF2, ELAV-type RNA-binding protein 3, RNA-binding protein BRUNOL-3, Bruno-like protein 3, CUG-BP2
Reference ARO-P12070
Note For research use only.
Molecular Constructor
Lys41–Asp211
Product name ARO-P12070-1MG
Uniprot ID O95319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFAD
Molecular weight 21.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys41-Asp211
Aliases /Synonyms CELF-2, hNAPOR, Neuroblastoma apoptosis-related RNA-binding protein, CUGBP Elav-like family member 2, CUG-BP- and ETR-3-like factor 2, BRUNOL3, NAPOR, ETR3, CUGBP2, CUG triplet repeat RNA-binding protein 2, ETR-3, CELF2, ELAV-type RNA-binding protein 3, RNA-binding protein BRUNOL-3, Bruno-like protein 3, CUG-BP2
Reference ARO-P12070
Note For research use only.
Molecular Constructor
Lys41–Asp211
Product name ARO-P12070-50
Uniprot ID O95319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFAD
Molecular weight 21.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys41-Asp211
Aliases /Synonyms CELF-2, hNAPOR, Neuroblastoma apoptosis-related RNA-binding protein, CUGBP Elav-like family member 2, CUG-BP- and ETR-3-like factor 2, BRUNOL3, NAPOR, ETR3, CUGBP2, CUG triplet repeat RNA-binding protein 2, ETR-3, CELF2, ELAV-type RNA-binding protein 3, RNA-binding protein BRUNOL-3, Bruno-like protein 3, CUG-BP2
Reference ARO-P12070
Note For research use only.
Molecular Constructor
Lys41–Asp211

Introduction to Recombinant Human CELF2 Protein

Recombinant Human CELF2 Protein, also known as CUGBP, Elav-like family member 2, is a protein that plays a crucial role in RNA processing and regulation of gene expression. It is a member of the CELF family of RNA-binding proteins, which are known to be involved in various cellular processes such as cell differentiation, proliferation, and apoptosis.

Structure of Recombinant Human CELF2 Protein

The Recombinant Human CELF2 Protein is a 62 kDa protein consisting of 522 amino acids. It contains three RNA recognition motifs (RRMs) that are responsible for binding to specific RNA sequences. These motifs are highly conserved among CELF family members and are essential for their function.

In addition to the RRMs, Recombinant Human CELF2 Protein also contains a nuclear localization signal, a nuclear export signal, and a serine-rich domain. These domains play a crucial role in the subcellular localization and function of the protein.

Activity of Recombinant Human CELF2 Protein

Recombinant Human CELF2 Protein is primarily involved in the regulation of RNA processing. It binds to specific RNA sequences and regulates their splicing, polyadenylation, and translation. This, in turn, affects the expression of various genes and ultimately impacts cellular processes.

One of the key functions of Recombinant Human CELF2 Protein is its role in alternative splicing. It has been shown to regulate the splicing of numerous pre-mRNAs, including those involved in muscle development, neuronal differentiation, and immune response. By binding to specific RNA sequences, Recombinant Human CELF2 Protein can either promote or repress splicing, thereby regulating the production of different protein isoforms.

Recombinant Human CELF2 Protein also plays a crucial role in the regulation of mRNA stability. It has been shown to bind to the 3′ untranslated region (UTR) of target mRNAs and regulate their stability. This, in turn, affects the amount of protein produced from these mRNAs and can have a significant impact on cellular function.

Application of Recombinant Human CELF2 Protein

Due to its important role in RNA processing and gene expression, Recombinant Human CELF2 Protein has been studied extensively in various fields of research. One of the major applications of this protein is in the field of cancer research.

Aberrant splicing has been linked to several types of cancer, and Recombinant Human CELF2 Protein has been shown to regulate the splicing of genes involved in cancer progression. This makes it a potential target for cancer therapy and a valuable tool for studying the mechanisms of cancer development.

Recombinant Human CELF2 Protein has also been implicated in various neurological disorders. It has been shown to play a role in neuronal differentiation and survival, and its dysregulation has been linked to neurodegenerative diseases such as Alzheimer’s and Parkinson’s. Therefore, understanding the function of this protein could provide valuable insights into these disorders and potentially lead to the development of new treatments.

In addition, Recombinant Human CELF2 Protein has been studied in the context of muscle development and heart disease. It has been shown to regulate the splicing of genes involved in muscle differentiation, and its dysregulation has been linked to cardiac hypertrophy and heart failure. Therefore, Recombinant Human CELF2 Protein could be a potential therapeutic target for these conditions.

Conclusion

Recombinant Human CELF2 Protein is a crucial protein involved in RNA processing and gene expression. Its structure, activity, and applications have been extensively studied, and it has been shown to play a critical role in various cellular processes. Understanding the function of this protein could have significant implications in the fields of cancer research, neurodegener

Recombinant Human CELF2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CELF2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products