Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99618
Molecular weight:
18.91 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Ser119–Ser268
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA3 Protein, N-His

Product name ARO-P10694-100
Uniprot ID Q99618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser119-Ser268
Aliases /Synonyms C8, TOME-1, CDCA3, GRCC8, Trigger of mitotic entry protein 1, Cell division cycle-associated protein 3, Gene-rich cluster protein C8, TOME1
Reference ARO-P10694
Note For research use only.
Molecular Constructor
Ser119–Ser268
Product name ARO-P10694-1MG
Uniprot ID Q99618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser119-Ser268
Aliases /Synonyms C8, TOME-1, CDCA3, GRCC8, Trigger of mitotic entry protein 1, Cell division cycle-associated protein 3, Gene-rich cluster protein C8, TOME1
Reference ARO-P10694
Note For research use only.
Molecular Constructor
Ser119–Ser268
Product name ARO-P10694-50
Uniprot ID Q99618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser119-Ser268
Aliases /Synonyms C8, TOME-1, CDCA3, GRCC8, Trigger of mitotic entry protein 1, Cell division cycle-associated protein 3, Gene-rich cluster protein C8, TOME1
Reference ARO-P10694
Note For research use only.
Molecular Constructor
Ser119–Ser268

The Structure of Recombinant Human CDCA3 Protein

Recombinant Human CDCA3 Protein, also known as cell division cycle associated protein 3, is a protein that plays a crucial role in regulating cell division and proliferation. It is a member of the cell division cycle (CDC) family of proteins, which are involved in various stages of the cell cycle.

The structure of Recombinant Human CDCA3 Protein is composed of 325 amino acids, with a molecular weight of approximately 36 kDa. It contains an N-terminal domain and a C-terminal domain, which are connected by a linker region. The N-terminal domain is responsible for protein-protein interactions, while the C-terminal domain has a conserved motif that is crucial for its function.

The Activity of Recombinant Human CDCA3 Protein

Recombinant Human CDCA3 Protein is involved in the regulation of cell cycle progression, specifically in the G2/M phase transition. It has been shown to interact with several other proteins, including cyclin B1, Cdc2, and p53, which are all key players in cell cycle regulation.

One of the main functions of Recombinant Human CDCA3 Protein is to promote mitotic entry by activating the Cdc2-cyclin B1 complex. This complex is responsible for the initiation of mitosis, and Recombinant Human CDCA3 Protein has been shown to enhance its activity. Additionally, Recombinant Human CDCA3 Protein has been found to be essential for proper chromosome segregation during mitosis.

The Application of Recombinant Human CDCA3 Protein

Recombinant Human CDCA3 Protein has a wide range of applications in both research and clinical settings. Its role in cell cycle regulation makes it a valuable tool for studying cell division and proliferation. It can be used in various in vitro and in vivo experiments to investigate its interaction with other proteins and its effects on cell cycle progression.

In addition, Recombinant Human CDCA3 Protein has potential clinical applications. It has been found to be overexpressed in several types of cancer, including lung, breast, and colon cancer. This makes it a potential diagnostic marker for these types of cancer, as well as a potential target for cancer therapy.

Furthermore, Recombinant Human CDCA3 Protein has been shown to play a role in drug resistance in cancer cells. It has been found to interact with proteins involved in drug metabolism and transport, suggesting that it may be involved in the development of drug resistance. This highlights its potential as a therapeutic target for overcoming drug resistance in cancer treatment.

Conclusion

In conclusion, Recombinant Human CDCA3 Protein is a crucial protein involved in cell cycle regulation and has a diverse range of functions. Its structure, with an N-terminal domain responsible for protein-protein interactions and a C-terminal domain crucial for its function, allows it to interact with other proteins and play a role in cell cycle progression. Its potential applications in research and clinical settings make it a valuable tool for understanding cell division and proliferation, as well as a potential diagnostic marker and therapeutic target for cancer.

Recombinant Human CDCA3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CDCA3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products