Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P21730
Molecular weight:
16.19 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Arg175–Arg206
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO

Product name ARO-P11312-100
Uniprot ID P21730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVREEYFPPKVLCGVDYSHDKRRERAVAIVR
Molecular weight 16.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg175-Arg206
Aliases /Synonyms CD88, C5AR1, C5R1, C5AR, C5a-R, C5aR, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor
Reference ARO-P11312
Note For research use only.
Molecular Constructor
Arg175–Arg206
Product name ARO-P11312-1MG
Uniprot ID P21730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVREEYFPPKVLCGVDYSHDKRRERAVAIVR
Molecular weight 16.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg175-Arg206
Aliases /Synonyms CD88, C5AR1, C5R1, C5AR, C5a-R, C5aR, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor
Reference ARO-P11312
Note For research use only.
Molecular Constructor
Arg175–Arg206
Product name ARO-P11312-50
Uniprot ID P21730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVREEYFPPKVLCGVDYSHDKRRERAVAIVR
Molecular weight 16.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg175-Arg206
Aliases /Synonyms CD88, C5AR1, C5R1, C5AR, C5a-R, C5aR, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor
Reference ARO-P11312
Note For research use only.
Molecular Constructor
Arg175–Arg206

Introduction to Recombinant Human CD88/C5AR1 Protein

Recombinant Human CD88/C5AR1 Protein, also known as C5a receptor 1 (C5AR1), is a protein that plays a crucial role in the immune system. This protein is encoded by the C5AR1 gene and is a member of the G protein-coupled receptor (GPCR) family. It is primarily expressed on the surface of immune cells, such as neutrophils, macrophages, and monocytes, and is involved in a variety of immune responses.

Structure of Recombinant Human CD88/C5AR1 Protein

The recombinant form of CD88/C5AR1 protein is produced through genetic engineering techniques, where the C5AR1 gene is inserted into a host cell, typically a bacterial or mammalian cell. The resulting protein is identical to the naturally occurring protein in terms of structure and function. The recombinant protein is typically produced in large quantities, making it a valuable tool for research and therapeutic purposes.

The structure of CD88/C5AR1 protein consists of seven transmembrane domains, with the N-terminus located on the extracellular side and the C-terminus on the intracellular side. This structure allows the protein to interact with other molecules, such as C5a, a complement protein that activates the immune response.

Activity of Recombinant Human CD88/C5AR1 Protein

The primary function of CD88/C5AR1 protein is to bind to C5a, a small peptide that is produced during the activation of the complement system. This binding triggers a signaling cascade within the cell, leading to various immune responses, including chemotaxis, degranulation, and production of inflammatory cytokines.

Chemotaxis is the process by which immune cells are attracted to the site of infection or injury. CD88/C5AR1 protein plays a crucial role in this process by guiding immune cells towards the source of C5a. This allows for a rapid and efficient response to potential threats.

CD88/C5AR1 protein also plays a role in degranulation, which is the release of enzymes and other substances from immune cells. This process helps to destroy pathogens and damaged cells at the site of infection or injury.

Furthermore, CD88/C5AR1 protein is involved in the production of inflammatory cytokines, which are signaling molecules that promote inflammation and recruit other immune cells to the site of infection or injury. This helps to amplify the immune response and eliminate potential threats.

Application of Recombinant Human CD88/C5AR1 Protein

Recombinant Human CD88/C5AR1 Protein has a wide range of applications in scientific research and medicine. One of the primary uses of this protein is in the study of immune responses and the development of new therapies for immune-related diseases.

For example, studies have shown that dysregulation of CD88/C5AR1 protein can contribute to the development of autoimmune diseases, such as rheumatoid arthritis and lupus. By studying the structure and function of this protein, researchers can gain a better understanding of these diseases and potentially develop targeted therapies to treat them.

In addition, recombinant CD88/C5AR1 protein is also used in the development of new drugs that target the complement system. By blocking the interaction between C5a and CD88/C5AR1, these drugs can inhibit the excessive immune response seen in conditions such as sepsis and acute respiratory distress syndrome.

Furthermore, recombinant CD88/C5AR1 protein has potential applications in cancer research. Studies have shown that this protein is overexpressed in certain types of cancer, and targeting it could potentially inhibit tumor growth

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CD88/C5AR1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products