Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD301/CLEC10A, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IUN9
Molecular weight:
21.30 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Thr71–Met239
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD301/CLEC10A, N-His

Product name ARO-P13260-100
Uniprot ID Q8IUN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWM
Molecular weight 21.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr71-Met239
Aliases /Synonyms CD301, Macrophage lectin 2, C-type lectin domain family 10 member A, CLECSF13, C-type lectin superfamily member 14, CLEC10A, CLECSF14, HML
Reference ARO-P13260
Note For research use only.
Molecular Constructor
Thr71–Met239
Product name ARO-P13260-1MG
Uniprot ID Q8IUN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWM
Molecular weight 21.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr71-Met239
Aliases /Synonyms CD301, Macrophage lectin 2, C-type lectin domain family 10 member A, CLECSF13, C-type lectin superfamily member 14, CLEC10A, CLECSF14, HML
Reference ARO-P13260
Note For research use only.
Molecular Constructor
Thr71–Met239
Product name ARO-P13260-50
Uniprot ID Q8IUN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWM
Molecular weight 21.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr71-Met239
Aliases /Synonyms CD301, Macrophage lectin 2, C-type lectin domain family 10 member A, CLECSF13, C-type lectin superfamily member 14, CLEC10A, CLECSF14, HML
Reference ARO-P13260
Note For research use only.
Molecular Constructor
Thr71–Met239

Introduction to Recombinant Human CD301/CLEC10A

Recombinant Human CD301/CLEC10A is a protein that plays a crucial role in the immune system. It is also known as Dendritic Cell Lectin-2 (DCL-2) or C-Type Lectin Domain Family 10 Member A (CLEC10A). This protein is encoded by the CLEC10A gene and is primarily expressed on the surface of dendritic cells, which are a type of immune cells responsible for initiating and regulating immune responses. Recombinant Human CD301/CLEC10A is a valuable tool for researchers studying the immune system and its role in various diseases.

Structure of Recombinant Human CD301/CLEC10A

Recombinant Human CD301/CLEC10A is a type II transmembrane protein, meaning it has a single transmembrane domain and a cytoplasmic tail. It is composed of 234 amino acids and has a molecular weight of approximately 25 kDa. The extracellular domain of this protein contains a C-type lectin-like domain, which is responsible for binding to specific carbohydrate structures on other molecules. The cytoplasmic tail of Recombinant Human CD301/CLEC10A contains a conserved tyrosine-based motif, which plays a role in intracellular signaling.

Activity of Recombinant Human CD301/CLEC10A

Recombinant Human CD301/CLEC10A is primarily expressed on the surface of dendritic cells, where it plays a crucial role in antigen presentation. Antigen presentation is a process by which dendritic cells present small pieces of foreign substances, known as antigens, to other immune cells. This process is essential for the activation of the immune response against pathogens and cancer cells. Recombinant Human CD301/CLEC10A is also involved in the regulation of immune responses by interacting with other immune cells and modulating their activity.

In addition to its role in the immune system, Recombinant Human CD301/CLEC10A has been shown to have anti-inflammatory properties. It has been found to inhibit the production of pro-inflammatory cytokines, which are signaling molecules involved in the inflammatory response. This suggests that Recombinant Human CD301/CLEC10A may have potential therapeutic applications in diseases characterized by excessive inflammation, such as autoimmune disorders.

Application of Recombinant Human CD301/CLEC10A

Recombinant Human CD301/CLEC10A has a wide range of applications in scientific research. It can be used as a tool to study the immune system and its role in various diseases. For example, researchers can use Recombinant Human CD301/CLEC10A to investigate the mechanisms of antigen presentation and immune regulation. It can also be used to study the interactions between immune cells and their role in immune responses.

Moreover, Recombinant Human CD301/CLEC10A has potential diagnostic and therapeutic applications. As a biomarker, it can be used to identify dendritic cells in tissue samples, which can provide valuable information about the immune response in diseases such as cancer. It can also be used as a therapeutic agent to modulate immune responses and potentially treat autoimmune disorders and other inflammatory conditions.

Conclusion

Recombinant Human CD301/CLEC10A is a protein with a crucial role in the immune system. Its structure, activity, and application make it a valuable tool for researchers studying the immune response and its role in diseases. With its potential diagnostic and therapeutic applications, Recombinant Human CD301/CLEC10A has the potential to contribute to the development of new treatments for various diseases. Further research on this protein will undoubtedly provide valuable insights into the functioning of the immune system and its potential for therapeutic intervention.

Keywords

Recombinant protein, antigen, CD301, CLEC10A, dendritic cells, immune system,

Recombinant Human CD301/CLEC10A, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD301/CLEC10A, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products