Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD156b/ADAM17, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78536
Molecular weight:
30.35 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
His Lys226–Arg473
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD156b/ADAM17, N-His

Product name ARO-P13554-100
Uniprot ID P78536
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQER
Molecular weight 30.35 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys226-Arg473
Aliases /Synonyms TACE, Snake venom-like protease, ADAM17, CD156b, CSVP, ADAM 17, Disintegrin and metalloproteinase domain-containing protein 17, TNF-alpha convertase, TNF-alpha-converting enzyme
Reference ARO-P13554
Note For research use only.
Molecular Constructor
His Lys226–Arg473
Product name ARO-P13554-1MG
Uniprot ID P78536
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQER
Molecular weight 30.35 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys226-Arg473
Aliases /Synonyms TACE, Snake venom-like protease, ADAM17, CD156b, CSVP, ADAM 17, Disintegrin and metalloproteinase domain-containing protein 17, TNF-alpha convertase, TNF-alpha-converting enzyme
Reference ARO-P13554
Note For research use only.
Molecular Constructor
His Lys226–Arg473
Product name ARO-P13554-50
Uniprot ID P78536
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQER
Molecular weight 30.35 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys226-Arg473
Aliases /Synonyms TACE, Snake venom-like protease, ADAM17, CD156b, CSVP, ADAM 17, Disintegrin and metalloproteinase domain-containing protein 17, TNF-alpha convertase, TNF-alpha-converting enzyme
Reference ARO-P13554
Note For research use only.
Molecular Constructor
His Lys226–Arg473

Introduction

Recombinant Human CD156b, also known as ADAM17, is a transmembrane protein belonging to the ADAM (a disintegrin and metalloproteinase) family. It is involved in various cellular processes such as cell adhesion, migration, and signaling. Recombinant Human CD156b/ADAM17 is a genetically engineered version of this protein that has been produced in a laboratory setting for research and therapeutic purposes. In this article, we will discuss the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Human CD156b/ADAM17

The human CD156b/ADAM17 gene is located on chromosome 2 and codes for a protein of 824 amino acids. The recombinant version of this protein is produced by inserting the gene into a suitable expression vector and introducing it into a host cell, typically a bacterial or mammalian cell. The resulting protein has the same amino acid sequence as the native protein, but with additional sequences added to facilitate purification and detection.

The structure of Recombinant Human CD156b/ADAM17 consists of several domains, including a prodomain, a metalloproteinase domain, a disintegrin domain, a cysteine-rich domain, an EGF-like domain, a transmembrane domain, and a cytoplasmic tail. The prodomain is responsible for regulating the activity of the metalloproteinase domain, which is the catalytic site of the protein. The disintegrin domain is involved in cell adhesion, while the cysteine-rich domain is important for protein-protein interactions. The EGF-like domain is responsible for binding to growth factors and other ligands, and the transmembrane domain anchors the protein to the cell membrane. The cytoplasmic tail is involved in intracellular signaling.

Activity of Recombinant Human CD156b/ADAM17

Recombinant Human CD156b/ADAM17 is a metalloproteinase that cleaves various substrates, including membrane-bound proteins, growth factors, and cytokines. This activity is crucial for processes such as cell proliferation, differentiation, and migration. The metalloproteinase domain of CD156b/ADAM17 is responsible for this activity, and it requires a zinc ion for its catalytic function. The activity of CD156b/ADAM17 is tightly regulated by its prodomain, which must be removed for the protein to become active.

In addition to its proteolytic activity, Recombinant Human CD156b/ADAM17 also plays a role in cell adhesion. The disintegrin domain of the protein binds to integrins, which are transmembrane proteins involved in cell-cell and cell-matrix interactions. By binding to integrins, CD156b/ADAM17 can regulate cell adhesion and migration.

Applications of Recombinant Human CD156b/ADAM17

Recombinant Human CD156b/ADAM17 has a wide range of applications in both research and therapeutic settings. In research, this protein is commonly used as an antigen in studies investigating its role in various cellular processes. It can also be used as a tool to study the function of other proteins that interact with CD156b/ADAM17, such as growth factors and cytokines.

In the field of therapeutics, Recombinant Human CD156b/ADAM17 has shown potential as a target for cancer treatment. The overexpression of CD156b/ADAM17 has been observed in various types of cancer, and it is associated with tumor growth and metastasis. Inhibitors of CD156b/ADAM17 have been developed and are currently being tested in clinical trials as potential cancer therapies.

Furthermore, Recombinant Human CD156b/ADAM17 has been implicated in inflammatory diseases such as rheumatoid arthritis and psoriasis. Inhibiting its activity has been shown to reduce inflammation in animal models, making it a potential therapeutic target for these conditions.

Conclusion</h2

SDS-PAGE for Recombinant Human CD156b/ADAM17, N-His

SDS-PAGE for Recombinant Human CD156b/ADAM17, N-His

Recombinant Human CD156b/ADAM17, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human CD156b/ADAM17, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD156b/ADAM17, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products