Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CCDC93 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q567U6
Molecular weight:
17.46 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Asp20–Ser151
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CCDC93 Protein, N-His

Product name ARO-P12250-100
Uniprot ID Q567U6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYS
Molecular weight 17.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp20-Ser151
Aliases /Synonyms CCDC93, Coiled-coil domain-containing protein 93
Reference ARO-P12250
Note For research use only.
Molecular Constructor
Asp20–Ser151
Product name ARO-P12250-1MG
Uniprot ID Q567U6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYS
Molecular weight 17.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp20-Ser151
Aliases /Synonyms CCDC93, Coiled-coil domain-containing protein 93
Reference ARO-P12250
Note For research use only.
Molecular Constructor
Asp20–Ser151
Product name ARO-P12250-50
Uniprot ID Q567U6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYS
Molecular weight 17.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp20-Ser151
Aliases /Synonyms CCDC93, Coiled-coil domain-containing protein 93
Reference ARO-P12250
Note For research use only.
Molecular Constructor
Asp20–Ser151

Introduction

Recombinant proteins have become an essential tool in biomedical research, drug development, and biotechnology due to their high specificity and functionality. One such protein is the Recombinant Human CCDC93 Protein, which has gained significant attention in recent years for its role in various cellular processes. In this article, we will provide a comprehensive overview of the structure, activity, and application of this protein.

Structure of Recombinant Human CCDC93 Protein

The Recombinant Human CCDC93 Protein, also known as Coiled-Coil Domain Containing 93, is a 27 kDa protein encoded by the CCDC93 gene located on chromosome 16. It belongs to the coiled-coil family of proteins, characterized by the presence of alpha-helical domains that form a coiled structure. The protein contains 230 amino acids and has a predicted isoelectric point of 8.6.

The primary structure of CCDC93 protein is highly conserved among different species, with human and mouse CCDC93 sharing 98% sequence identity. The protein also contains a coiled-coil domain from amino acid 84 to 126, which is essential for its function. Furthermore, the protein has two predicted transmembrane domains, indicating its potential localization in the cell membrane.

Activity of Recombinant Human CCDC93 Protein

The Recombinant Human CCDC93 Protein is involved in various cellular processes, including cell proliferation, apoptosis, and cell cycle regulation. It has been shown to interact with multiple proteins, suggesting its role in protein-protein interactions. One of its key functions is its involvement in the regulation of the Wnt signaling pathway, which plays a crucial role in embryonic development and tissue homeostasis.

Studies have also shown that CCDC93 protein is essential for the proper functioning of the Golgi apparatus, a cellular organelle involved in protein sorting and secretion. It has been suggested that CCDC93 protein may play a role in Golgi membrane fusion and vesicle trafficking, although the exact mechanism is still under investigation.

Application of Recombinant Human CCDC93 Protein

Due to its diverse functions, the Recombinant Human CCDC93 Protein has several potential applications in the field of biomedical research. One of its primary uses is as an antigen in immunological studies. The protein has been shown to elicit a strong immune response, making it a suitable candidate for the development of diagnostic tests and vaccines.

Moreover, CCDC93 protein has been identified as a potential therapeutic target in various diseases, including cancer and neurodegenerative disorders. Its involvement in the Wnt signaling pathway makes it a promising target for the treatment of Wnt-related cancers, such as colon and breast cancer. Additionally, studies have shown that CCDC93 protein plays a critical role in the pathogenesis of Alzheimer’s disease, making it a potential target for drug development.

Conclusion

The Recombinant Human CCDC93 Protein is a multifunctional protein with diverse roles in cellular processes. Its unique structure and activity make it an essential tool in biomedical research and potential therapeutic target for various diseases. As our understanding of this protein continues to evolve, we can expect to see more applications and potential uses for Recombinant Human CCDC93 Protein in the future.

Recombinant Human CCDC93 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CCDC93 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products