Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CBS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P35520
Molecular weight:
55.30 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Lys72–Lys551
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CBS Protein, N-His

Product name ARO-P12616-100
Uniprot ID P35520
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Molecular weight 55.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys72-Lys551
Aliases /Synonyms Serine sulfhydrase, CBS, Cystathionine beta-synthase, Beta-thionase
Reference ARO-P12616
Note For research use only.
Molecular Constructor
Lys72–Lys551
Product name ARO-P12616-1MG
Uniprot ID P35520
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Molecular weight 55.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys72-Lys551
Aliases /Synonyms Serine sulfhydrase, CBS, Cystathionine beta-synthase, Beta-thionase
Reference ARO-P12616
Note For research use only.
Molecular Constructor
Lys72–Lys551
Product name ARO-P12616-50
Uniprot ID P35520
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Molecular weight 55.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys72-Lys551
Aliases /Synonyms Serine sulfhydrase, CBS, Cystathionine beta-synthase, Beta-thionase
Reference ARO-P12616
Note For research use only.
Molecular Constructor
Lys72–Lys551

Introduction

The production of recombinant proteins has revolutionized the field of biotechnology and has opened up new avenues for research and therapeutic applications. One such protein that has gained significant attention is the recombinant human CBS protein. This protein is a key enzyme involved in the production of cysteine, an essential amino acid required for various biological processes. In this article, we will delve into the structure, activity, and applications of recombinant human CBS protein.

Structure of Recombinant Human CBS Protein

The recombinant human CBS protein is a homodimeric enzyme consisting of two identical subunits, each with a molecular weight of approximately 63 kDa. Each subunit is composed of three domains – a catalytic domain, a regulatory domain, and a heme-binding domain. The catalytic domain is responsible for the enzymatic activity of CBS, while the regulatory domain plays a crucial role in the regulation of enzyme activity. The heme-binding domain is responsible for binding and stabilizing the heme group, which is essential for the proper functioning of the enzyme.

Activity of Recombinant Human CBS Protein

The primary function of recombinant human CBS protein is to catalyze the condensation of serine and homocysteine to form cystathionine, which is further converted to cysteine. This reaction is a crucial step in the transsulfuration pathway, which is responsible for the production of cysteine, an essential amino acid required for the synthesis of proteins, glutathione, and other important biomolecules. In addition to its role in cysteine production, CBS also plays a critical role in the metabolism of homocysteine, a toxic amino acid that can lead to various health conditions if not properly regulated.

The activity of recombinant human CBS protein is tightly regulated by several factors, including the binding of heme, S-adenosylmethionine (SAM), and the presence of allosteric effectors such as adenosine triphosphate (ATP) and S-adenosylhomocysteine (SAH). The binding of heme to the heme-binding domain is essential for the proper folding and stability of the enzyme. SAM, an important methyl donor, acts as a positive regulator of CBS, while ATP and SAH act as negative regulators.

Applications of Recombinant Human CBS Protein

Recombinant human CBS protein has a wide range of applications in both research and therapeutics. In research, it is used to study the role of CBS in various biological processes and to understand the mechanisms involved in the regulation of its activity. The recombinant protein can also be used to screen for potential inhibitors or activators of CBS, which can aid in the development of new drugs for the treatment of CBS-related diseases.

In therapeutics, recombinant human CBS protein has shown promising results in the treatment of homocystinuria, a rare genetic disorder caused by a deficiency in CBS activity. This condition leads to the accumulation of homocysteine in the body, which can cause severe health problems such as cardiovascular disease, developmental delays, and skeletal abnormalities. The administration of recombinant human CBS protein has been shown to reduce homocysteine levels and improve the symptoms of homocystinuria.

Conclusion

In conclusion, recombinant human CBS protein is a vital enzyme with a complex structure and tightly regulated activity. Its role in the production of cysteine and regulation of homocysteine makes it a crucial protein in various biological processes. With its wide range of applications in research and therapeutics, recombinant human CBS protein continues to be a valuable tool in the field of biotechnology, offering new insights into the functioning of this essential enzyme.

Recombinant Human CBS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CBS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products