Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CAVIN2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95810
Molecular weight:
15.15 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Glu45–Lys156
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CAVIN2 Protein, N-His

Product name ARO-P12266-100
Uniprot ID O95810
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFK
Molecular weight 15.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu45-Lys156
Aliases /Synonyms Caveolae-associated protein 2, SDPR, CAVIN2, Serum deprivation-response protein, Cavin-2, PS-p68, Phosphatidylserine-binding protein
Reference ARO-P12266
Note For research use only.
Molecular Constructor
Glu45–Lys156
Product name ARO-P12266-1MG
Uniprot ID O95810
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFK
Molecular weight 15.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu45-Lys156
Aliases /Synonyms Caveolae-associated protein 2, SDPR, CAVIN2, Serum deprivation-response protein, Cavin-2, PS-p68, Phosphatidylserine-binding protein
Reference ARO-P12266
Note For research use only.
Molecular Constructor
Glu45–Lys156
Product name ARO-P12266-50
Uniprot ID O95810
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFK
Molecular weight 15.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu45-Lys156
Aliases /Synonyms Caveolae-associated protein 2, SDPR, CAVIN2, Serum deprivation-response protein, Cavin-2, PS-p68, Phosphatidylserine-binding protein
Reference ARO-P12266
Note For research use only.
Molecular Constructor
Glu45–Lys156

Introduction

Recombinant Human CAVIN2 Protein is a protein that has been produced through genetic engineering techniques, specifically recombinant DNA technology. This protein is a member of the CAVIN family, which plays an important role in the formation and maintenance of caveolae, small invaginations in the plasma membrane that are involved in various cellular processes. In this article, we will explore the structure, activity, and applications of Recombinant Human CAVIN2 Protein.

Structure of Recombinant Human CAVIN2 Protein

Recombinant Human CAVIN2 Protein is a 42 kDa protein that is composed of 376 amino acids. It is encoded by the CAVIN2 gene, which is located on chromosome 7 in humans. The protein contains a N-terminal coiled-coil domain, a phosphoinositide-binding domain, and a C-terminal domain that interacts with caveolin-1, a key protein involved in caveolae formation. This structure is essential for the proper functioning of CAVIN2 in caveolae formation and maintenance.

Activity of Recombinant Human CAVIN2 Protein

The main activity of Recombinant Human CAVIN2 Protein is its role in the formation and maintenance of caveolae. These specialized structures are involved in various cellular processes, including signal transduction, lipid metabolism, and endocytosis. CAVIN2 interacts with caveolin-1 to form a complex that is necessary for the formation of caveolae. It also plays a role in regulating the size and number of caveolae, as well as their stability.

In addition to its role in caveolae formation, Recombinant Human CAVIN2 Protein has been found to have other functions. It has been shown to interact with other proteins involved in cell signaling and membrane trafficking, suggesting a potential role in these processes as well. Furthermore, CAVIN2 has been linked to diseases such as cancer and cardiovascular disorders, highlighting its importance in maintaining cellular homeostasis.

Applications of Recombinant Human CAVIN2 Protein

The production of Recombinant Human CAVIN2 Protein has opened up many possibilities for its use in various applications. One of the main applications is in the study of caveolae and its role in cellular processes. Recombinant CAVIN2 can be used in in vitro experiments to investigate the mechanisms of caveolae formation and maintenance, as well as its interaction with other proteins.

Another potential application of Recombinant Human CAVIN2 Protein is in drug discovery and development. As CAVIN2 has been linked to diseases such as cancer and cardiovascular disorders, understanding its role and function can aid in the development of targeted therapies. Recombinant CAVIN2 can be used in screening assays to identify potential drugs that can modulate its activity and potentially treat these diseases.

Furthermore, Recombinant Human CAVIN2 Protein can also be used in diagnostic tests. As it is a key protein involved in caveolae formation, its levels or mutations may serve as biomarkers for certain diseases. Recombinant CAVIN2 can be used to develop diagnostic tests that can detect these biomarkers, aiding in early detection and treatment of diseases.

Conclusion

In summary, Recombinant Human CAVIN2 Protein is a key protein involved in the formation and maintenance of caveolae, with potential roles in other cellular processes. Its structure, activity, and applications make it a valuable tool in the study of caveolae and its role in diseases. With further research and development, Recombinant CAVIN2 has the potential to contribute to the understanding and treatment of various diseases.

Recombinant Human CAVIN2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CAVIN2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products