Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CA5B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2D0
Molecular weight:
34.88 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Cys34–Pro317
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CA5B, N-His

Product name ARO-P12985-100
Uniprot ID Q9Y2D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Molecular weight 34.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys34-Pro317
Aliases /Synonyms CA-VB, Carbonic anhydrase VB, Carbonic anhydrase 5B, mitochondrial, Carbonate dehydratase VB, CA5B
Reference ARO-P12985
Note For research use only.
Molecular Constructor
Cys34–Pro317
Product name ARO-P12985-1MG
Uniprot ID Q9Y2D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Molecular weight 34.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys34-Pro317
Aliases /Synonyms CA-VB, Carbonic anhydrase VB, Carbonic anhydrase 5B, mitochondrial, Carbonate dehydratase VB, CA5B
Reference ARO-P12985
Note For research use only.
Molecular Constructor
Cys34–Pro317
Product name ARO-P12985-50
Uniprot ID Q9Y2D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Molecular weight 34.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys34-Pro317
Aliases /Synonyms CA-VB, Carbonic anhydrase VB, Carbonic anhydrase 5B, mitochondrial, Carbonate dehydratase VB, CA5B
Reference ARO-P12985
Note For research use only.
Molecular Constructor
Cys34–Pro317

Introduction

Recombinant Human CA5B is a protein that has gained significant interest in the scientific community due to its unique structure and diverse range of applications. In this article, we will explore the structure, activity, and potential applications of this recombinant protein.

Structure of Recombinant Human CA5B

Recombinant Human CA5B is a member of the carbonic anhydrase (CA) family of enzymes, which are responsible for catalyzing the reversible hydration of carbon dioxide to bicarbonate. This enzyme is encoded by the CA5B gene and is composed of 254 amino acids with a molecular weight of approximately 29 kDa.

The protein structure of Recombinant Human CA5B consists of a single polypeptide chain with a zinc ion at the active site. This zinc ion is essential for the catalytic activity of the enzyme, as it serves as a proton acceptor during the hydration reaction. The protein also contains a conserved histidine residue, which acts as a proton donor.

In addition to its catalytic domain, Recombinant Human CA5B also contains a transmembrane domain that anchors the protein to the cell membrane. This unique structure allows for the efficient transport of carbon dioxide and bicarbonate across the cell membrane, making it an essential enzyme for various physiological processes.

Activity of Recombinant Human CA5B

The primary function of Recombinant Human CA5B is to catalyze the hydration of carbon dioxide, which is a crucial step in many physiological processes, including respiration, acid-base balance, and bone formation. This enzyme is highly expressed in various tissues, including the lungs, kidneys, and bones, indicating its essential role in these organs.

Studies have shown that Recombinant Human CA5B has a higher catalytic activity compared to other carbonic anhydrases, making it a promising enzyme for industrial and therapeutic applications. Additionally, this enzyme has been found to have a higher affinity for carbon dioxide, allowing for a more efficient conversion to bicarbonate.

Furthermore, Recombinant Human CA5B has been shown to have a role in regulating intracellular pH, which is crucial for cellular homeostasis. This enzyme is also involved in the production of bicarbonate, which is necessary for maintaining the acid-base balance in the body.

Applications of Recombinant Human CA5B

The unique structure and activity of Recombinant Human CA5B make it a valuable tool for various applications in both research and industry. One of the most significant uses of this enzyme is in the production of biocatalysts for carbon dioxide capture and utilization. The efficient conversion of carbon dioxide to bicarbonate by Recombinant Human CA5B can aid in reducing greenhouse gas emissions and mitigating climate change.

Moreover, Recombinant Human CA5B has potential therapeutic applications in treating diseases that involve abnormal pH levels, such as glaucoma, osteoporosis, and certain cancers. This enzyme has also been studied for its role in bone formation and regeneration, making it a promising target for bone-related disorders.

Furthermore, Recombinant Human CA5B has been used in diagnostic assays for the detection of carbonic anhydrase autoantibodies, which have been linked to autoimmune diseases such as Sjögren’s syndrome and rheumatoid arthritis.

Conclusion

In summary, Recombinant Human CA5B is a unique enzyme with a crucial role in carbon dioxide metabolism and pH regulation. Its distinct structure and high catalytic activity make it a valuable tool for various applications in industry and medicine. Further research on this enzyme’s potential therapeutic and industrial uses may lead to new developments and advancements in these fields.

Recombinant Human CA5B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CA5B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products