Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human BMP10 Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95393
Molecular weight:
39.31 kDa

Original price was: €384.00.Current price is: €325.00.

100ug 15% OFF + 325 loyalty points
GST Arg315–Arg424
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human BMP10 Protein, N-GST

Product name ARO-P14492-100
Uniprot ID O95393
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
Molecular weight 39.31 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg315-Arg424
Aliases /Synonyms BMP-10, Bone morphogenetic protein 10, BMP10
Reference ARO-P14492
Note For research use only.
Molecular Constructor
GST Arg315–Arg424
Product name ARO-P14492-1MG
Uniprot ID O95393
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
Molecular weight 39.31 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg315-Arg424
Aliases /Synonyms BMP-10, Bone morphogenetic protein 10, BMP10
Reference ARO-P14492
Note For research use only.
Molecular Constructor
GST Arg315–Arg424
Product name ARO-P14492-50
Uniprot ID O95393
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
Molecular weight 39.31 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg315-Arg424
Aliases /Synonyms BMP-10, Bone morphogenetic protein 10, BMP10
Reference ARO-P14492
Note For research use only.
Molecular Constructor
GST Arg315–Arg424

There are no reviews yet.

Be the first to review “Recombinant Human BMP10 Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products