Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human BCO1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HAY6
Molecular weight:
25.25 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Gly6–Pro206
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human BCO1, N-His

Product name ARO-P12903-100
Uniprot ID Q9HAY6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSFTIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIVEKGKTKYVIFKIPATVP
Molecular weight 25.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly6-Pro206
Aliases /Synonyms BCMO1, Beta,beta-carotene 15,15'-dioxygenase, BCDO, BCO1, Beta-carotene oxygenase 1, BCDO1, Beta-carotene dioxygenase 1
Reference ARO-P12903
Note For research use only.
Molecular Constructor
Gly6–Pro206
Product name ARO-P12903-1MG
Uniprot ID Q9HAY6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSFTIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIVEKGKTKYVIFKIPATVP
Molecular weight 25.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly6-Pro206
Aliases /Synonyms BCMO1, Beta,beta-carotene 15,15'-dioxygenase, BCDO, BCO1, Beta-carotene oxygenase 1, BCDO1, Beta-carotene dioxygenase 1
Reference ARO-P12903
Note For research use only.
Molecular Constructor
Gly6–Pro206
Product name ARO-P12903-50
Uniprot ID Q9HAY6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSFTIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIVEKGKTKYVIFKIPATVP
Molecular weight 25.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly6-Pro206
Aliases /Synonyms BCMO1, Beta,beta-carotene 15,15'-dioxygenase, BCDO, BCO1, Beta-carotene oxygenase 1, BCDO1, Beta-carotene dioxygenase 1
Reference ARO-P12903
Note For research use only.
Molecular Constructor
Gly6–Pro206

Introduction

Recombinant human BCO1 (Beta-Carotene Oxygenase 1) is a key enzyme involved in the metabolism of beta-carotene, a dietary source of vitamin A. This enzyme is encoded by the BCO1 gene and is primarily expressed in the liver and intestine. Recombinant human BCO1 has gained significant attention in the scientific community due to its potential therapeutic and industrial applications. In this article, we will discuss the structure, activity and application of recombinant human BCO1 in detail.

Structure of Recombinant Human BCO1

Recombinant human BCO1 is a 63 kDa protein consisting of 575 amino acids. It belongs to the carotenoid oxygenase family and has a conserved catalytic domain with a characteristic di-iron binding motif. The crystal structure of recombinant human BCO1 has been determined, revealing a unique fold with a central beta-sheet surrounded by alpha-helices. This structure is highly conserved across different species, indicating the importance of BCO1 in beta-carotene metabolism.

Activity of Recombinant Human BCO1

Recombinant human BCO1 acts as a key enzyme in the conversion of beta-carotene to retinol, the active form of vitamin A. This process involves the cleavage of beta-carotene into two molecules of retinal, which is then reduced to retinol by retinol dehydrogenase. The activity of recombinant human BCO1 is dependent on the presence of oxygen and iron ions, which act as cofactors in the catalytic reaction. Studies have shown that the activity of recombinant human BCO1 can be modulated by various factors such as pH, temperature, and substrate concentration.

Application of Recombinant Human BCO1

Therapeutic Applications

Recombinant human BCO1 has potential therapeutic applications in the treatment of vitamin A deficiency and related diseases. Deficiency of vitamin A is a major global health problem, especially in developing countries. Recombinant human BCO1 can be used to produce retinol, which can then be used as a dietary supplement to combat vitamin A deficiency. In addition, studies have shown that recombinant human BCO1 can also be used to produce retinoids, which have been used in the treatment of various diseases such as cancer, skin disorders, and eye diseases.

Industrial Applications

Recombinant human BCO1 also has potential industrial applications in the food and feed industry. Beta-carotene is a widely used food additive for its antioxidant and colorant properties. However, its low bioavailability limits its application. Recombinant human BCO1 can be used to enhance the bioavailability of beta-carotene by converting it to retinol, which is more easily absorbed by the body. This can lead to the development of functional foods with increased nutritional value. In addition, recombinant human BCO1 can also be used in the production of animal feed to improve the vitamin A status of livestock.

Research Applications

Recombinant human BCO1 is a valuable tool for research in the field of carotenoid metabolism. It can be used to study the role of BCO1 in various physiological processes and to understand the mechanisms underlying vitamin A deficiency and related diseases. Recombinant human BCO1 can also be used to screen for potential inhibitors or activators of the enzyme, which can aid in the development of novel therapeutics.

Conclusion

In conclusion, recombinant human BCO1 is a crucial enzyme involved in the metabolism of beta-carotene and has significant potential in various

Recombinant Human BCO1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human BCO1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products