Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P27540
Molecular weight:
24.69 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Thr361–Val464
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO

Product name ARO-P11204-100
Uniprot ID P27540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Molecular weight 24.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr361-Val464
Aliases /Synonyms ARNT, Dioxin receptor, nuclear translocator, ARNT protein, bHLHe2, BHLHE2, Aryl hydrocarbon receptor nuclear translocator, Hypoxia-inducible factor 1-beta, HIF1-beta, Class E basic helix-loop-helix protein 2, HIF-1-beta
Reference ARO-P11204
Note For research use only.
Molecular Constructor
Thr361–Val464
Product name ARO-P11204-1MG
Uniprot ID P27540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Molecular weight 24.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr361-Val464
Aliases /Synonyms ARNT, Dioxin receptor, nuclear translocator, ARNT protein, bHLHe2, BHLHE2, Aryl hydrocarbon receptor nuclear translocator, Hypoxia-inducible factor 1-beta, HIF1-beta, Class E basic helix-loop-helix protein 2, HIF-1-beta
Reference ARO-P11204
Note For research use only.
Molecular Constructor
Thr361–Val464
Product name ARO-P11204-50
Uniprot ID P27540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Molecular weight 24.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr361-Val464
Aliases /Synonyms ARNT, Dioxin receptor, nuclear translocator, ARNT protein, bHLHe2, BHLHE2, Aryl hydrocarbon receptor nuclear translocator, Hypoxia-inducible factor 1-beta, HIF1-beta, Class E basic helix-loop-helix protein 2, HIF-1-beta
Reference ARO-P11204
Note For research use only.
Molecular Constructor
Thr361–Val464

Introduction

Recombinant Human ARNT/HIF1-beta Protein is a type of recombinant protein that plays a crucial role in regulating gene expression and cellular responses to hypoxia. This protein is a member of the basic helix-loop-helix (bHLH) transcription factor family and is also known as the Aryl hydrocarbon receptor nuclear translocator (ARNT) or hypoxia-inducible factor 1-beta (HIF1-beta). In this article, we will discuss the structure, activity, and application of this important protein.

Structure of Recombinant Human ARNT/HIF1-beta Protein

The recombinant human ARNT/HIF1-beta protein is composed of 789 amino acids and has a molecular weight of approximately 90 kDa. It consists of several functional domains, including a bHLH domain, a PAS-A domain, a PAS-B domain, and a transactivation domain. The bHLH domain is responsible for DNA binding, while the PAS domains are involved in protein-protein interactions and sensing oxygen levels. The transactivation domain is responsible for activating target genes.

Activity of Recombinant Human ARNT/HIF1-beta Protein

The main function of recombinant human ARNT/HIF1-beta protein is to regulate gene expression in response to hypoxia, or low oxygen levels. Under normoxic conditions, this protein forms a complex with another bHLH protein, HIF1-alpha, and binds to specific DNA sequences known as hypoxia response elements (HREs) in the promoter regions of target genes. This complex acts as a transcription factor, activating the expression of genes involved in cellular responses to hypoxia, such as angiogenesis, erythropoiesis, and glycolysis. In addition to its role in hypoxia, ARNT/HIF1-beta is also involved in other cellular processes, including circadian rhythm regulation, lipid metabolism, and immune response.

Application of Recombinant Human ARNT/HIF1-beta Protein

Recombinant human ARNT/HIF1-beta protein has a wide range of applications in both basic research and clinical settings. One of its main uses is in studying the molecular mechanisms of hypoxia and its effects on gene expression. Researchers can use recombinant ARNT/HIF1-beta protein to investigate the role of this protein in various cellular processes and its interaction with other proteins.

In addition, recombinant ARNT/HIF1-beta protein is also used in drug discovery and development. As hypoxia plays a crucial role in various diseases, such as cancer, cardiovascular diseases, and neurodegenerative disorders, targeting the ARNT/HIF1-beta pathway has been identified as a potential therapeutic strategy. Recombinant ARNT/HIF1-beta protein can be used in high-throughput screening assays to identify compounds that modulate its activity, thus providing potential drug candidates for further development.

Moreover, recombinant human ARNT/HIF1-beta protein is also used in diagnostic assays for various diseases. As this protein is involved in regulating the expression of genes related to hypoxia, it can be used as an antigen in immunoassays to detect the presence of hypoxia-related biomarkers in patient samples.

Conclusion

In summary, recombinant human ARNT/HIF1-beta protein is a crucial player in regulating gene expression and cellular responses to hypoxia. Its structure, activity, and applications make it an essential tool for studying hypoxia and its role in various diseases. With ongoing research and advancements in recombinant protein technology, the potential applications of ARNT/HIF1-beta protein are continuously expanding, making it a valuable protein in the field of molecular biology and medicine.

Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products