Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARL2BP Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2Y0
Molecular weight:
17.91 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Met1–Glu133
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARL2BP Protein, N-His

Product name ARO-P11860-100
Uniprot ID Q9Y2Y0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKE
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu133
Aliases /Synonyms BART1, Binder of ARF2 protein 1, ARL2-binding protein, ARF-like 2-binding protein, BART, ARL2BP, ADP-ribosylation factor-like protein 2-binding protein
Reference ARO-P11860
Note For research use only.
Molecular Constructor
Met1–Glu133
Product name ARO-P11860-1MG
Uniprot ID Q9Y2Y0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKE
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu133
Aliases /Synonyms BART1, Binder of ARF2 protein 1, ARL2-binding protein, ARF-like 2-binding protein, BART, ARL2BP, ADP-ribosylation factor-like protein 2-binding protein
Reference ARO-P11860
Note For research use only.
Molecular Constructor
Met1–Glu133
Product name ARO-P11860-50
Uniprot ID Q9Y2Y0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKE
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu133
Aliases /Synonyms BART1, Binder of ARF2 protein 1, ARL2-binding protein, ARF-like 2-binding protein, BART, ARL2BP, ADP-ribosylation factor-like protein 2-binding protein
Reference ARO-P11860
Note For research use only.
Molecular Constructor
Met1–Glu133

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of a specific protein. One such recombinant protein is the Recombinant Human ARL2BP Protein, which has gained significant attention in the scientific community due to its unique structure, activity, and potential applications. In this article, we will delve into the details of this protein and explore its role in various biological processes.

Structure of Recombinant Human ARL2BP Protein

The Recombinant Human ARL2BP Protein, also known as ADP-ribosylation factor-like 2 binding protein, is a 21-kDa protein that consists of 186 amino acids. It is encoded by the ARL2BP gene and is highly conserved across different species, indicating its important role in cellular processes. The protein contains a conserved ARL2-binding domain and a C-terminal domain that is responsible for its interaction with other proteins.

The crystal structure of Recombinant Human ARL2BP Protein has been determined, revealing a unique fold with two domains connected by a flexible linker. The N-terminal domain forms a seven-stranded β-sheet, while the C-terminal domain consists of three helices and a four-stranded β-sheet. This structure is essential for the protein’s function, as it allows for its interaction with various binding partners.

Activity of Recombinant Human ARL2BP Protein

The primary function of Recombinant Human ARL2BP Protein is to act as a guanine nucleotide exchange factor (GEF) for the small GTPase ARL2. This means that it promotes the exchange of GDP for GTP, leading to the activation of ARL2. ARL2 is involved in several cellular processes, including cytoskeletal organization, vesicle trafficking, and cell division, making Recombinant Human ARL2BP Protein a crucial regulator of these processes.

In addition to its role as a GEF, Recombinant Human ARL2BP Protein has been found to interact with other proteins, such as the microtubule-associated protein MAP1S and the tubulin-binding protein TBCB. These interactions suggest that the protein may also play a role in microtubule dynamics and organization, further highlighting its importance in cellular processes.

Applications of Recombinant Human ARL2BP Protein

The unique structure and activity of Recombinant Human ARL2BP Protein make it a valuable tool in various research areas. For example, its role as a GEF for ARL2 makes it a potential target for drug development, as dysregulation of ARL2 has been linked to diseases such as cancer and neurodegeneration. Inhibitors of Recombinant Human ARL2BP Protein could potentially be used to modulate ARL2 activity and treat these diseases.

Furthermore, Recombinant Human ARL2BP Protein has been used in studies to investigate its role in microtubule dynamics and its potential as a therapeutic target for diseases involving microtubule dysfunction. It has also been shown to interact with the hepatitis C virus (HCV) core protein, suggesting a possible role in HCV infection and potential for antiviral therapies.

Additionally, Recombinant Human ARL2BP Protein has been used in structural studies to understand its binding partners and their interactions. This information can aid in the development of new therapeutics that target these interactions.

Conclusion

In summary, the Recombinant Human ARL2BP Protein is a crucial player in various cellular processes, acting as a GEF for ARL2 and interacting with other proteins involved in microtubule dynamics. Its unique structure and activity make it a valuable tool for research and a potential

Recombinant Human ARL2BP Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARL2BP Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products