Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AKAP3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75969
Molecular weight:
16.21 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Ala726–Leu853
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AKAP3 Protein, N-His

Product name ARO-P11619-100
Uniprot ID O75969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala726-Leu853
Aliases /Synonyms Fibrousheathin I, AKAP110, CT82, Fibrous sheath protein of 95 kDa, FSP95, Fibrousheathin-1, A-kinase anchor protein 110 kDa, AKAP3, Protein kinase A-anchoring protein 3, Cancer/testis antigen 82, AKAP 110, AKAP-3, Sperm oocyte-binding protein, SOB1, A-kinase anchor protein 3, PRKA3
Reference ARO-P11619
Note For research use only.
Molecular Constructor
Ala726–Leu853
Product name ARO-P11619-1MG
Uniprot ID O75969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala726-Leu853
Aliases /Synonyms Fibrousheathin I, AKAP110, CT82, Fibrous sheath protein of 95 kDa, FSP95, Fibrousheathin-1, A-kinase anchor protein 110 kDa, AKAP3, Protein kinase A-anchoring protein 3, Cancer/testis antigen 82, AKAP 110, AKAP-3, Sperm oocyte-binding protein, SOB1, A-kinase anchor protein 3, PRKA3
Reference ARO-P11619
Note For research use only.
Molecular Constructor
Ala726–Leu853
Product name ARO-P11619-50
Uniprot ID O75969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala726-Leu853
Aliases /Synonyms Fibrousheathin I, AKAP110, CT82, Fibrous sheath protein of 95 kDa, FSP95, Fibrousheathin-1, A-kinase anchor protein 110 kDa, AKAP3, Protein kinase A-anchoring protein 3, Cancer/testis antigen 82, AKAP 110, AKAP-3, Sperm oocyte-binding protein, SOB1, A-kinase anchor protein 3, PRKA3
Reference ARO-P11619
Note For research use only.
Molecular Constructor
Ala726–Leu853

Introduction

Recombinant Human AKAP3 Protein, also known as A-kinase anchor protein 3, is a type of protein that plays a crucial role in the regulation of cellular signaling pathways. This protein is encoded by the AKAP3 gene and is a member of the A-kinase anchor protein family. Recombinant Human AKAP3 Protein is produced through genetic engineering techniques and has various applications in the field of biotechnology and medicine.

Structure of Recombinant Human AKAP3 Protein

Recombinant Human AKAP3 Protein is a large protein consisting of 1,322 amino acids with a molecular weight of approximately 150 kDa. It contains multiple domains, including a protein kinase A (PKA) binding domain, a leucine zipper domain, and a coiled-coil domain. These domains are responsible for the interaction of AKAP3 with other proteins and its localization within the cell.

Activity of Recombinant Human AKAP3 Protein

Recombinant Human AKAP3 Protein is primarily known for its role as an anchor protein for PKA, a key enzyme involved in the regulation of various cellular processes. AKAP3 binds to PKA and targets it to specific locations within the cell, allowing for precise control of PKA activity. This protein also interacts with other signaling molecules, such as protein kinase C and protein phosphatase 2A, to further regulate cellular signaling pathways.

In addition to its role in regulating signaling pathways, Recombinant Human AKAP3 Protein has been found to play a role in sperm motility and male fertility. It is highly expressed in the testes and has been shown to be essential for the proper function of sperm cells. AKAP3 interacts with other proteins in the sperm flagellum, the structure responsible for sperm movement, and is crucial for the development of functional sperm cells.

Application of Recombinant Human AKAP3 Protein

Recombinant Human AKAP3 Protein has various applications in the field of biotechnology and medicine. Its ability to interact with and regulate PKA activity makes it a valuable tool for studying cellular signaling pathways. Researchers can use this protein to manipulate PKA activity and study its effects on different cellular processes.

In addition, Recombinant Human AKAP3 Protein has potential therapeutic applications. Its role in sperm motility and male fertility makes it a potential target for the development of male contraceptives. Furthermore, abnormalities in AKAP3 expression have been linked to male infertility, and further research on this protein may lead to new treatments for this condition.

Moreover, Recombinant Human AKAP3 Protein can also be used as an antigen for the development of diagnostic tests for certain diseases. Antibodies against AKAP3 have been found in patients with autoimmune disorders, making it a potential biomarker for these conditions. By using Recombinant Human AKAP3 Protein as an antigen, specific and sensitive diagnostic tests can be developed to aid in the early detection and treatment of these diseases.

Conclusion

In conclusion, Recombinant Human AKAP3 Protein is a crucial protein involved in the regulation of cellular signaling pathways and sperm motility. Its structure and activity make it a valuable tool for studying cellular processes and have potential applications in biotechnology and medicine. Further research on this protein may lead to new treatments for male infertility and the development of diagnostic tests for autoimmune disorders.

Recombinant Human AKAP3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AKAP3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products