Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ACVRL1/ALK-1 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P37023
Molecular weight:
11.81 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Asp22–Gln118
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ACVRL1/ALK-1 Protein, C-His

Product name ARO-P10854-100
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 11.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10854
Note For research use only.
Molecular Constructor
Asp22–Gln118
Product name ARO-P10854-1MG
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 11.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10854
Note For research use only.
Molecular Constructor
Asp22–Gln118
Product name ARO-P10854-50
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 11.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10854
Note For research use only.
Molecular Constructor
Asp22–Gln118

Introduction

Recombinant Human ACVRL1/ALK-1 Protein, also known as Activin Receptor-Like Kinase 1 (ALK-1), is a type I cell surface receptor belonging to the TGF-β superfamily. It is encoded by the ACVRL1 gene and is expressed in various tissues, including the endothelium, smooth muscle cells, and hematopoietic cells. The protein plays a crucial role in regulating cell growth, differentiation, and angiogenesis, making it a valuable tool in both research and therapeutic applications.

Structure of Recombinant Human ACVRL1/ALK-1 Protein

The recombinant form of ACVRL1/ALK-1 protein is produced through genetic engineering techniques, using human cells as hosts. It is a homodimer consisting of two identical subunits, each with a molecular weight of approximately 60 kDa. The protein contains a large extracellular domain, a transmembrane domain, and an intracellular domain with serine/threonine kinase activity. The extracellular domain is responsible for ligand binding, while the intracellular domain is involved in signal transduction.

Activity of Recombinant Human ACVRL1/ALK-1 Protein

The main function of ACVRL1/ALK-1 protein is to mediate the signaling of TGF-β superfamily ligands, including bone morphogenetic proteins (BMPs) and activins. Upon ligand binding, the protein undergoes conformational changes, leading to the activation of its kinase domain. This, in turn, triggers downstream signaling pathways, such as the SMAD pathway, resulting in the regulation of gene expression. The activity of ACVRL1/ALK-1 protein is essential for various cellular processes, including cell proliferation, differentiation, and migration.

Application of Recombinant Human ACVRL1/ALK-1 Protein

The recombinant form of ACVRL1/ALK-1 protein has a wide range of applications in both research and therapeutic settings. Some of the key applications include:

1. Research Tool

Recombinant Human ACVRL1/ALK-1 Protein is widely used as a research tool to study the role of TGF-β superfamily signaling in various cellular processes. It can be used to investigate the function of ACVRL1/ALK-1 protein in different cell types and its interaction with ligands and other signaling molecules. The protein can also be used to screen for potential inhibitors or activators of the ACVRL1/ALK-1 signaling pathway.

2. Therapeutic Target

Due to its critical role in angiogenesis, ACVRL1/ALK-1 protein has emerged as a potential therapeutic target for various diseases, including cancer and cardiovascular disorders. Inhibitors of ACVRL1/ALK-1 signaling have been shown to inhibit tumor growth and metastasis, making them promising candidates for cancer treatment. In cardiovascular disorders, targeting ACVRL1/ALK-1 signaling can help regulate blood vessel formation and prevent diseases such as pulmonary arterial hypertension and hereditary hemorrhagic telangiectasia.

3. Diagnostic Marker

Mutations in the ACVRL1 gene have been linked to hereditary hemorrhagic telangiectasia, a rare genetic disorder characterized by abnormal blood vessel formation. Recombinant Human ACVRL1/ALK-1 Protein can be used as a diagnostic marker to detect these mutations and aid in the diagnosis of this disorder. Additionally, the protein can also be used as a biomarker for angiogenesis-related diseases, as its expression is upregulated in various types of cancer.

4. Vaccine Development

Recombinant Human ACVRL1/ALK-1 Protein has also been investigated as a potential vaccine candidate for cancer immunotherapy. Studies have

Recombinant Human ACVRL1/ALK-1 Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human ACVRL1/ALK-1 Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products