Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ACO1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P21399
Molecular weight:
26.96 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
His Lys26–Ile243
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ACO1 Protein, N-His

Product name ARO-P14811-100
Uniprot ID P21399
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVI
Molecular weight 26.96 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys26-Ile243
Aliases /Synonyms Ferritin repressor protein, IRP1, ACO1, IREB1, Citrate hydro-lyase, IRE-BP 1, Iron-responsive element-binding protein 1, Aconitase, Cytoplasmic aconitate hydratase, Iron regulatory protein 1
Reference ARO-P14811
Note For research use only.
Molecular Constructor
His Lys26–Ile243
Product name ARO-P14811-1MG
Uniprot ID P21399
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVI
Molecular weight 26.96 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys26-Ile243
Aliases /Synonyms Ferritin repressor protein, IRP1, ACO1, IREB1, Citrate hydro-lyase, IRE-BP 1, Iron-responsive element-binding protein 1, Aconitase, Cytoplasmic aconitate hydratase, Iron regulatory protein 1
Reference ARO-P14811
Note For research use only.
Molecular Constructor
His Lys26–Ile243
Product name ARO-P14811-50
Uniprot ID P21399
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVI
Molecular weight 26.96 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys26-Ile243
Aliases /Synonyms Ferritin repressor protein, IRP1, ACO1, IREB1, Citrate hydro-lyase, IRE-BP 1, Iron-responsive element-binding protein 1, Aconitase, Cytoplasmic aconitate hydratase, Iron regulatory protein 1
Reference ARO-P14811
Note For research use only.
Molecular Constructor
His Lys26–Ile243

SDS-PAGE for Recombinant Human ACO1 Protein, N-His

SDS-PAGE for Recombinant Human ACO1 Protein, N-His

Recombinant Human ACO1 Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human ACO1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products