Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human metapneumovirus (strain CAN97-83) (HMPV
Uniprot ID:
Q6WB96
Molecular weight:
36.24 kDa

Original price was: €271.00.Current price is: €228.00.

50ug 16% OFF + 228 loyalty points
GST Thr2–Ser71 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His

Product name ARO-P15733-100
Uniprot ID Q6WB96
Origin species Human metapneumovirus (strain CAN97-83) (HMPV
Expression system Prokaryotic expression
Raw Antigen Sequence TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Molecular weight 36.24 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser71
Aliases /Synonyms Protein M2-2, M2
Reference ARO-P15733
Note For research use only.
Molecular Constructor
GST Thr2–Ser71 His
Product name ARO-P15733-1MG
Uniprot ID Q6WB96
Origin species Human metapneumovirus (strain CAN97-83) (HMPV
Expression system Prokaryotic expression
Raw Antigen Sequence TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Molecular weight 36.24 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser71
Aliases /Synonyms Protein M2-2, M2
Reference ARO-P15733
Note For research use only.
Molecular Constructor
GST Thr2–Ser71 His
Product name ARO-P15733-50
Uniprot ID Q6WB96
Origin species Human metapneumovirus (strain CAN97-83) (HMPV
Expression system Prokaryotic expression
Raw Antigen Sequence TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Molecular weight 36.24 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser71
Aliases /Synonyms Protein M2-2, M2
Reference ARO-P15733
Note For research use only.
Molecular Constructor
GST Thr2–Ser71 His

There are no reviews yet.

Be the first to review “Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products